SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017388 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017388
Domain Number 1 Region: 885-1013,1217-1403
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-45
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 483-575
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000091
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 3 Region: 574-676
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000094
Family Other IPT/TIG domains 0.077
Further Details:      
 
Domain Number 4 Region: 37-89
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000353
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 397-486
Classification Level Classification E-value
Superfamily E set domains 0.000000000091
Family Other IPT/TIG domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000017388
Domain Number - Region: 3-39
Classification Level Classification E-value
Superfamily Sema domain 0.000392
Family Sema domain 0.018
Further Details:      
 
Domain Number - Region: 690-745
Classification Level Classification E-value
Superfamily E set domains 0.0114
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 
Domain Number - Region: 192-226
Classification Level Classification E-value
Superfamily Plexin repeat 0.0222
Family Plexin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017388   Gene: ENSTRUG00000007076   Transcript: ENSTRUT00000017462
Sequence length 1433
Comment pep:known_by_projection scaffold:FUGU4:scaffold_215:189024:199706:1 gene:ENSTRUG00000007076 transcript:ENSTRUT00000017462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVDSGSSINADLLLDQSQQHIYVLTNSRLSKVPVSSCERQTDCQSCLAVRDPYCGWCVLE
GRCSRKQQCQRHSQPNQWFWSFEATSQCVNVQNLQPASQSRAEQNQVTLSVVQLPVLTEA
ESLSCVFGLLPPQPAVVTGTSITCQSPVPELLPPMPTGSDHMILPVSLVFGHVTIATSNM
TFYDCGAVSRLNQSSQCLACVTSVWRCNWCPLDQLCTHNHSCPNQHVILSQRESPGPTSC
PLVFGLQSSALVPLGMTTSLVLRGRNLDVYTKDEAPYECVVEIKGVQHRLAAAVEKSHDN
TDTFICSPHQYSVPIYLCRGERRIDASPGLRLQLYDCSAGQSDCSQCRAVPEEYGCVWCP
GSPSPGCVYNQSCSRTPEDSWPTSSDYTGPIKGCVSVPQVQPLSGPLEGGILVTISGSNL
GMRYDVVGGITVAGVPCPPQAEGYHISTRVVCELQPSGKQREGPVMVRVGAAPPGESRQV
FTYQDPQILSLVPDKGPVSGGTQLTIRGQQLLTGQKSDLRAFLGVQSCYSLEEVNDTHLV
CQTASSNQTGGVVVRVLFGKAERTIGSMKFRYLDDPVITEASPAESFYAGGRVIMVTGRN
LDVVQQPILAVWVEPVEVMERCSILSSSQMTCRTPEVSADFKIKGVWFQMDNVRIHFESI
KSVLYTLGQSFTYYPNPDFFRLNREAPNAPYRFKPGGVIAVEGQDLTRAISRQEVTARLG
NEECEVKTLDNTHLYCEPPEVQPIHQVFMGNLQVDLGLVQYDSDSLLSPVPLAAQIGLAG
GAAIIILSVLVVILMYRRKSKQALRDYKKVLVQLETLEINVGDQCRKEFTDLMTEMMDLS
SDVGGPGLPLLDYKTYAERVFFPGQHVAPLTRQLDLPESRRQTVEQGLQQLNNLLNNRLF
LTRFIHTLEAQQGFSQRDRGYVASLLTMALHDKLEYFTEVMKTLLQDLVQQYVAKNPKLM
LRRTETVVEKMLTNWMSICLYSFLKEVAGEPLYMLYRAIKYQVDKGPVDSVTGKAKRTLN
DSHLLREDIDYSAMTLTVLVKNGVEVQPCPVKVLDIDTITQVKDKILDQVYRGAPFSQRP
AADSLDLEWRSGQAGHLTLSDDDVTAVVHGRWKRLNTLQHYKVPDGATVALIPRSQSSGG
VGVNQVFQTGESNKIQNTPKTTTGASGSLKEQTPMLEGEEEEGLRLWHLVKSSEDPDIPK
HRKSSMRDRERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILSTKRPPPIAVRFFFDFLD
DMAEKHGIDDPETVHIWKTNSLPLRFWVNILKNPQFVLDVQVTDSIDAVLSVIAQTFIDS
CTTSEHKVGRDSPVNKLLYAREIPRYKQLVERYYSDIHSAASGCYQEMNSTLTELSGSFA
SEMNNLVALHELYKYINKYYDQIIMSLDEDSSGQKMQLAYRLQQVAALVENKV
Download sequence
Identical sequences H2SYA0
ENSTRUP00000017388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]