SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017584 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017584
Domain Number 1 Region: 52-181
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-26
Family Toll/Interleukin receptor TIR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017584   Gene: ENSTRUG00000007154   Transcript: ENSTRUT00000017658
Sequence length 207
Comment pep:known scaffold:FUGU4:scaffold_131:291362:292282:1 gene:ENSTRUG00000007154 transcript:ENSTRUT00000017658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGWFQKILNFRVSFSAHDQHVGKEAKQSSGSSSFCPLSSSWTPTVPQSVVGSALSCARK
YDVFVCHSSVDSDSEEAARLVSFLEAPPRSFRCFLQERDECPGGAISTELCQAVQDSHIW
VLLITPNFLKDAWCHYMMHQALAEGAMFSRIIPLVLNLSDSQYPQELKFFCYIDLSDNLD
RGYSRLSDTVHLYLKDWAQKEKSSGLM
Download sequence
Identical sequences H2SYU6
31033.ENSTRUP00000017584 ENSTRUP00000017584 ENSTRUP00000017584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]