SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018920 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018920
Domain Number 1 Region: 15-488
Classification Level Classification E-value
Superfamily Sema domain 1.12e-167
Family Sema domain 0.000000000022
Further Details:      
 
Domain Number 2 Region: 484-535
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000331
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 547-631
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000106
Family I set domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018920   Gene: ENSTRUG00000007631   Transcript: ENSTRUT00000018998
Sequence length 725
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:181250:195881:-1 gene:ENSTRUG00000007631 transcript:ENSTRUT00000018998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPVSFPDLQQFHGVRRFELERSCCFSALLLDEERGRLFVGAKNFLLSLSLDNIAKQEHKI
YWPAPVDWREECNWAGKDITVNVDEYIKHTHTHTHTHTHTLQSWSLESFCCACYCLDEKT
HMRIDPSKVEDGKGKSPYDPRHNAASVLVGDELYAGVATDLMGRDFTIFRSMGRRPSIRT
EQHDSRWLNEPKFVGSFWVPESENPDDDKVFFFFRETAVEAQGLGKSTYSRIGQLCRNDM
GGQRSLVNKWTTFLKTRLICSVPGADGSDTYFDELRDVFLLQTRDRKNPLVYTVFSTSSS
SVFKGSAVCLYSMNDIRRAFLGPFAHKEGPNYQWVPFQGKVPYPRPGMCPSKTFGSFEST
KGFPDDVIQFARHHPLMYNPVYPMTRRPIFVRTNVDYSFTQIAVDRVGAADGQYDVMFIG
TDKGTVLKVINVPKGSWNNMEELLLEELEVFKDASSIINMQISSKRQQLYVGSATGIAQV
PLHRCSVYGKACAECCLARDPYCAWDGTSCTRYLPNTKRRFRRQDVRNGDPNTLCSGDHH
KYRVAEKKLYGVEGSSTFLECIPKSLQARVTWTFQKHPQNPREEVRLDDRILQTDRGLLI
RRVLKRDIGVYQCHAMEHGFTQTLLGITLEVVPSTSSSASNLPSDAPVRLDPRSGGAPPA
TNQKLWYRDFMQLVDHPNLSTVDQICEQVWARKNAAGDQIRKGRNRRTHDGKPNPRAPRS
AGRHW
Download sequence
Identical sequences H2T2N2
ENSTRUP00000018920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]