SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018925 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018925
Domain Number 1 Region: 1-464
Classification Level Classification E-value
Superfamily Sema domain 3.27e-166
Family Sema domain 0.0000000000204
Further Details:      
 
Domain Number 2 Region: 460-511
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000942
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 526-610
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000101
Family I set domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018925   Gene: ENSTRUG00000007631   Transcript: ENSTRUT00000019003
Sequence length 705
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:182773:195809:-1 gene:ENSTRUG00000007631 transcript:ENSTRUT00000019003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSALLLDEERGRLFVGAKNFLLSLSLDNIAKQEHKIYWPAPVDWREECNWAGKDITGSCQ
IRTDTHTHTHTHTHTLGCGARTQWLAQQRFGRTQDHVFRIDPSKVEDGKGKSPYDPRHNA
ASVLVGDELYAGVATDLMGRDFTIFRSMGRRPSIRTEQHDSRWLNEPKFVGSFWVPESEN
PDDDKVFFFFRETAVEAQGLGKSTYSRIGQLCRNDMGGQRSLVNKWTTFLKTRLICSVPG
ADGSDTYFDELRDVFLLQTRDRKNPLVYTVFSTSSSSVFKGSAVCLYSMNDIRRAFLGPF
AHKEGPNYQWVPFQGKVPYPRPGMCPSKTFGSFESTKGFPDDVIQFARHHPLMYNPVYPM
TRRPIFVRTNVDYSFTQIAVDRVGAADGQYDVMFIGTDKGTVLKVINVPKGSWNNMEELL
LEELEVFKDASSIINMQISSKRQQLYVGSATGIAQVPLHRCSVYGKACAECCLARDPYCA
WDGTSCTRYLPNTKRRFRRQDVRNGDPNTLCSGVFSYHHKYRVAEKKLYGVEGSSTFLEC
IPKSLQARVTWTFQKHPQNPREEVRLDDRILQTDRGLLIRRVLKRDIGVYQCHAMEHGFT
QTLLGITLEVVPSTSSSASNLPSDAPVRLDPRSGGAPPATNQKLWYRDFMQLVDHPNLST
VDQICEQVWAHVPPLGPSVRPGNKKWKHLQEIRKGRNRRTHDGKP
Download sequence
Identical sequences H2T2N7
ENSTRUP00000018925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]