SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018927 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018927
Domain Number 1 Region: 26-503
Classification Level Classification E-value
Superfamily Sema domain 1.57e-167
Family Sema domain 0.000000000016
Further Details:      
 
Domain Number 2 Region: 499-551
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000244
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 563-647
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000101
Family I set domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018927   Gene: ENSTRUG00000007631   Transcript: ENSTRUT00000019005
Sequence length 708
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:182929:197079:-1 gene:ENSTRUG00000007631 transcript:ENSTRUT00000019005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSSSSSSSSPRMKLSYKDLQQFHGVRRFELERSCCFSALLLDEERGRLFVGAKNFLLSL
SLDNIAKQEHKIYWPAPVDWREECNWAGKDITTDAELANFLPDTHTHTHTHTHTLGCGAR
TQWLAQQRFGRTQDHVFRIDPSKVEDGKGKSPYDPRHNAASVLVGDELYAGVATDLMGRD
FTIFRSMGRRPSIRTEQHDSRWLNEPKFVGSFWVPESENPDDDKVFFFFRETAVEAQGLG
KSTYSRIGQLCRNDMGGQRSLVNKWTTFLKTRLICSVPGADGSDTYFDELRDVFLLQTRD
RKNPLVYTVFSTSSSSVFKGSAVCLYSMNDIRRAFLGPFAHKEGPNYQWVPFQGKVPYPR
PGMCPSKTFGSFESTKGFPDDVIQFARHHPLMYNPVYPMTRRPIFVRTNVDYSFTQIAVD
RVGAADGQYDVMFIGTDKGTVLKVINVPKGSWNNMEELLLEELEVFKDASSIINMQISSK
RQQLYVGSATGIAQVPLHRCSVYGKACAECCLARDPYCAWDGTSCTRYLPNTKSRRFRRQ
DVRNGDPNTLCSGDHHKYRVAEKKLYGVEGSSTFLECIPKSLQARVTWTFQKHPQNPREE
VRLDDRILQTDRGLLIRRVLKRDIGVYQCHAMEHGFTQTLLGITLEVVPSTSSSASNLPS
DAPVRLDPRSGGAPPATNQKLWYRDFMQLVDHPNLSTVDQICEQVWAR
Download sequence
Identical sequences H2T2N9
ENSTRUP00000018927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]