SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019573 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019573
Domain Number 1 Region: 137-381
Classification Level Classification E-value
Superfamily vWA-like 3.56e-70
Family Integrin A (or I) domain 0.000000725
Further Details:      
 
Domain Number 2 Region: 397-471
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000115
Family Integrin domains 0.0024
Further Details:      
 
Domain Number 3 Region: 40-94
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000837
Family Plexin repeat 0.00093
Further Details:      
 
Domain Number 4 Region: 587-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000215
Family Integrin beta EGF-like domains 0.0038
Further Details:      
 
Domain Number 5 Region: 545-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000026
Family Integrin beta EGF-like domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000019573
Domain Number - Region: 513-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00201
Family Integrin beta EGF-like domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019573   Gene: ENSTRUG00000007871   Transcript: ENSTRUT00000019653
Sequence length 642
Comment pep:known_by_projection scaffold:FUGU4:scaffold_45:323725:331639:1 gene:ENSTRUG00000007871 transcript:ENSTRUT00000019653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSRRGSVNMTTWLRSVPLCVLLYSALSLCAQDHGAAGGAMCLSASITSCAECLSHGPQC
AWCFKEDFLNGADLGWRCDLPENLLNRGCEAESMERWETKVVVNTTISSTQVSPGDISIT
LTPGSEASVVVAVKQLQRYPVDLYYLVDVSASMQENLNHLKTVGVALTLRMTEHSSDLWL
GFGSFVDKPVSPYIDVHPSKINNPCSDYEIRCRPAHGFHHVLSMTGNMSEFTRVIKRQHI
SGNMDTPEGGLDAMLQAAVCQEAVGWRSEAKRLLLLMTDQPSHLALDSRLAGIVVPHDGL
CHLENNVYTGSTRMDHPSVGQLSDKLLENHIYSVFAVEKQQYQWYEELVRLLPAAYLGKL
GLFQAPNLIELVVEAYKRLLSEVEVSISVEDKAVDRYSVSVSPICPEGSTLKGQSCSGVQ
PNQTTYFKITFGLRSCPDDGGDEDVTVLIHPVGYNESTVVRIHSKCVCSCGVTKRCSNDG
QSPCSGMQDEDRGPNHELMDSNKGSNRNCRPDVADVDCSGRGVCECGRCVCDRSKLGAVY
GKYCEIDDFSCPYHEGLSCGGRGACVSSECVCTDGWTGESCSCPISTATCQSASGSLCSG
RGRCVCGKCACDDPQYSGDFCETCPACQSPCQSHWKCVDCHL
Download sequence
Identical sequences H2T4I5
ENSTRUP00000019573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]