SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019574 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019574
Domain Number 1 Region: 123-367
Classification Level Classification E-value
Superfamily vWA-like 4.67e-70
Family Integrin A (or I) domain 0.000000725
Further Details:      
 
Domain Number 2 Region: 383-457
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000141
Family Integrin domains 0.0024
Further Details:      
 
Domain Number 3 Region: 26-80
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000942
Family Plexin repeat 0.00093
Further Details:      
 
Domain Number 4 Region: 573-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family Integrin beta EGF-like domains 0.0038
Further Details:      
 
Domain Number 5 Region: 616-695
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000693
Family Integrin beta tail domain 0.0025
Further Details:      
 
Domain Number 6 Region: 531-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Integrin beta EGF-like domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000019574
Domain Number - Region: 499-531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00234
Family Integrin beta EGF-like domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019574   Gene: ENSTRUG00000007871   Transcript: ENSTRUT00000019654
Sequence length 726
Comment pep:known_by_projection scaffold:FUGU4:scaffold_45:324674:333948:1 gene:ENSTRUG00000007871 transcript:ENSTRUT00000019654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHFYPWVNVTFSNILLLCYSLSAGGAMCLSASITSCAECLSHGPQCAWCFKEDFLNGADL
GWRCDLPENLLNRGCEAESMERWETKVVVNTTISSTQVSPGDISITLTPGSEASVVVAVK
QLQRYPVDLYYLVDVSASMQENLNHLKTVGVALTLRMTEHSSDLWLGFGSFVDKPVSPYI
DVHPSKINNPCSDYEIRCRPAHGFHHVLSMTGNMSEFTRVIKRQHISGNMDTPEGGLDAM
LQAAVCQEAVGWRSEAKRLLLLMTDQPSHLALDSRLAGIVVPHDGLCHLENNVYTGSTRM
DHPSVGQLSDKLLENHIYSVFAVEKQQYQWYEELVRLLPAAYLGKLGLFQAPNLIELVVE
AYKRLLSEVEVSISVEDKAVDRYSVSVSPICPEGSTLKGQSCSGVQPNQTTYFKITFGLR
SCPDDGGDEDVTVLIHPVGYNESTVVRIHSKCVCSCGVTKRCSNDGQSPCSGMQDEDRGP
NHELMDSNKGSNRNCRPDVADVDCSGRGVCECGRCVCDRSKLGAVYGKYCEIDDFSCPYH
EGLSCGGRGACVSSECVCTDGWTGESCSCPISTATCQSASGSLCSGRGRCVCGKCACDDP
QYSGDFCETCPACQSPCQSHWKCVDCHLSHGLAPKEAGHCNSTCIPLVGYVDDTSGHVGG
VQCMYINNDSCRYQFQTRSQYGQAMLYISTRPECASSSRMVGTFLSVCALTVLCGLVVVA
FSRLLL
Download sequence
Identical sequences H2T4I6
ENSTRUP00000019574 ENSTRUP00000019574 31033.ENSTRUP00000019574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]