SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000019906 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000019906
Domain Number 1 Region: 23-113
Classification Level Classification E-value
Superfamily BAG domain 6.08e-25
Family BAG domain 0.0000703
Further Details:      
 
Domain Number 2 Region: 383-471
Classification Level Classification E-value
Superfamily BAG domain 3.92e-24
Family BAG domain 0.00035
Further Details:      
 
Domain Number 3 Region: 179-289
Classification Level Classification E-value
Superfamily BAG domain 2.75e-22
Family BAG domain 0.0018
Further Details:      
 
Domain Number 4 Region: 295-374
Classification Level Classification E-value
Superfamily BAG domain 0.00000000000536
Family BAG domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000019906   Gene: ENSTRUG00000007997   Transcript: ENSTRUT00000019987
Sequence length 472
Comment pep:known_by_projection scaffold:FUGU4:scaffold_237:333496:335005:-1 gene:ENSTRUG00000007997 transcript:ENSTRUT00000019987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHGGPQQQHHHQPQQQHPMGQQQPYYPQHPAMMRLYEVQRDAAALGPQVCTFGGLQNDR
DYKRLERDLTQLLLQVDQVDTEGKAELQGARKRAAQEVEGLLRYLEENATHPSRLAMEEL
SNEARRLVDERVVAPQRAGGVAEINDELVDMLQELVLRLTQVKTEGRVPLRKARYRALTR
LCAVQDVIEGRTEQQTLSLPLSEETHEAVHHINQVMVKVSVARGQLVALLMGLSGRDSCA
HLSRILTEMQVELDALDVSGNTAIRNYRKQVVEEINGLLKHLDLEVEGDDTRRYDLAQNN
SIREIEAVRAHVSHLREGVLRHCMMGDMGFRPKAELQSLLTHLDQVDTAKNPCIREARRR
AVVEVQAVITFLDLREALARRQPGPNEHPSHRAVWLVLGSLSDLQAQVLGFDGKRADKSY
MMLEELLTKQLLALDAVDPQGDEMTKMARKQAVKFAQNILNYLDMKTDEWEY
Download sequence
Identical sequences H2T5G7
31033.ENSTRUP00000019906 ENSTRUP00000019906 XP_011618665.1.43653 XP_011618671.1.43653 XP_011618677.1.43653 XP_011618684.1.43653 XP_011618690.1.43653 ENSTRUP00000019906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]