SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020873 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020873
Domain Number 1 Region: 30-126
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.24e-43
Family SWIB/MDM2 domain 0.0000605
Further Details:      
 
Domain Number 2 Region: 283-326
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 9.42e-19
Family Ran binding protein zinc finger-like 0.00025
Further Details:      
 
Domain Number 3 Region: 193-272
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 0.000015
Family SWIB/MDM2 domain 0.028
Further Details:      
 
Domain Number 4 Region: 440-491
Classification Level Classification E-value
Superfamily RING/U-box 0.0000232
Family RING finger domain, C3HC4 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020873   Gene: ENSTRUG00000008338   Transcript: ENSTRUT00000020960
Sequence length 497
Comment pep:known_by_projection scaffold:FUGU4:scaffold_21:238140:241229:1 gene:ENSTRUG00000008338 transcript:ENSTRUT00000020960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVYSSQVCGQILFRTTDSIIVSSRAASCLDLQVRPNVEFHRLLQDAGAIKDVFTMKEVMF
YLGQYIIQKQLYDQKQQHIVHCSHDELGRVLGVDSFSVKEPRVLFAMIMKNLVAVKNPES
SSQSDSNTDDQREKQEEPATPEEEELQEQRSSLSPTHWRSSGPSHNVDNEGNEESEDEEE
GDVRKRRRSDSYSLTFDDSLSWCVIGGLGGGRDRHSSQSSDSHSTSVRSEVTLADPDSDS
DNFSVEFEVESIASDDYNEDDASVSADDQVYEVTIFEAEDEDSFDEDTEITEADYWRCVK
CDELNPPLPRNCLRCWTLRRDWLPEELSKSASSSPKALPPSSDLETDGVDLPDGKNAKTL
PSSQCLSDSTLSVPDSSQDLCSSSQDLCSSSQPASSSSQLFPSSLDSQEPASTSPAGDPA
SATPELERSVSAEWRLPDSCLDPCLICQSRPKNGCIVHGRTGHLISCYVCARKLKKRNKL
CPVCRMPIQSVILTYLS
Download sequence
Identical sequences H2T883
ENSTRUP00000020873 ENSTRUP00000020873 31033.ENSTRUP00000020873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]