SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020874 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020874
Domain Number 1 Region: 17-117
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.7e-44
Family SWIB/MDM2 domain 0.0000433
Further Details:      
 
Domain Number 2 Region: 274-317
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 9.16e-19
Family Ran binding protein zinc finger-like 0.00025
Further Details:      
 
Domain Number 3 Region: 184-263
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 0.0000144
Family SWIB/MDM2 domain 0.028
Further Details:      
 
Domain Number 4 Region: 431-482
Classification Level Classification E-value
Superfamily RING/U-box 0.0000228
Family RING finger domain, C3HC4 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020874   Gene: ENSTRUG00000008338   Transcript: ENSTRUT00000020961
Sequence length 488
Comment pep:known_by_projection scaffold:FUGU4:scaffold_21:238490:241229:1 gene:ENSTRUG00000008338 transcript:ENSTRUT00000020961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCRIVIMSADRELSTDASDDNKLVRPNVEFHRLLQDAGAIKDVFTMKEVMFYLGQYIIQK
QLYDQKQQHIVHCSHDELGRVLGVDSFSVKEPRVLFAMIMKNLVAVKNPESSSQSDSNTD
DQREKQEEPATPEEEELQEQRSSLSPTHWRSSGPSHNVDNEGNEESEDEEEGDVRKRRRS
DSYSLTFDDSLSWCVIGGLGGGRDRHSSQSSDSHSTSVRSEVTLADPDSDSDNFSVEFEV
ESIASDDYNEDDASVSADDQVYEVTIFEAEDEDSFDEDTEITEADYWRCVKCDELNPPLP
RNCLRCWTLRRDWLPEELSKSASSSPKALPPSSDLETDGVDLPDGKNAKTLPSSQCLSDS
TLSVPDSSQDLCSSSQDLCSSSQPASSSSQLFPSSLDSQEPASTSPAGDPASATPELERS
VSAEWRLPDSCLDPCLICQSRPKNGCIVHGRTGHLISCYVCARKLKKRNKLCPVCRMPIQ
SVILTYLS
Download sequence
Identical sequences H2T884
ENSTRUP00000020874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]