SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020876 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020876
Domain Number 1 Region: 17-113
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.14e-43
Family SWIB/MDM2 domain 0.0000605
Further Details:      
 
Domain Number 2 Region: 270-313
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 8.63e-19
Family Ran binding protein zinc finger-like 0.00025
Further Details:      
 
Domain Number 3 Region: 415-466
Classification Level Classification E-value
Superfamily RING/U-box 0.0000341
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000020876
Domain Number - Region: 172-259
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 0.000157
Family SWIB/MDM2 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020876   Gene: ENSTRUG00000008338   Transcript: ENSTRUT00000020963
Sequence length 472
Comment pep:known_by_projection scaffold:FUGU4:scaffold_21:238578:241229:1 gene:ENSTRUG00000008338 transcript:ENSTRUT00000020963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLTDSIIVSSRAASCLDLQVRPNVEFHRLLQDAGAIKDVFTMKEVMFYLGQYIIQKQLYD
QKQQHIVHCSHDELGRVLGVDSFSVKEPRVLFAMIMKNLVAVKNPESSSQSDSNTDDQRE
KSEEAADCSSPDRRSRRRRRRRSCRSSDPGNEESEDEEEGDVRKRRRSDSYSLTFDDSLS
WCVIGGLGGGRDRHSSQSSDSHSTNDNHVRLQSVRSEVTLADPDSDSDNFSVEFEVESIA
SDDYNEDDASVSADDQVYEVTIFEAEDEDSFDEDTEITEADYWRCVKCDELNPPLPRNCL
RCWTLRRDWLPEELSKSASSSPKALPPKPNDQSAANEAPGSDLETDGVDLPDGKNAKTLP
SSQCLSDPASSSSQLFPSSLDSQEPASTSPAGDPASATPELERSVSAEWRLPDSCLDPCL
ICQSRPKNGCIVHGRTGHLISCYVCARKLKKRNKLCPVCRMPIQSVILTYLS
Download sequence
Identical sequences H2T886
ENSTRUP00000020876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]