SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020877 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020877
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 2.09e-42
Family SWIB/MDM2 domain 0.0000712
Further Details:      
 
Domain Number 2 Region: 240-283
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 5.89e-19
Family Ran binding protein zinc finger-like 0.00025
Further Details:      
 
Domain Number 3 Region: 383-434
Classification Level Classification E-value
Superfamily RING/U-box 0.0000204
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000020877
Domain Number - Region: 164-233
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 0.0111
Family SWIB/MDM2 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020877   Gene: ENSTRUG00000008338   Transcript: ENSTRUT00000020964
Sequence length 440
Comment pep:known_by_projection scaffold:FUGU4:scaffold_21:238623:241229:1 gene:ENSTRUG00000008338 transcript:ENSTRUT00000020964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDLQVRPNVEFHRLLQDAGAIKDVFTMKEVMFYLGQYIIQKQLYDQKQQHIVHCSHDELG
RVLGVDSFSVKEPRVLFAMIMKNLVAVKNPGEPALKESSSQSDSNTDDQREKSEEAADCS
SPDRRSRRRRRRRSCRSSDPGPSHNVDNEGNEESEDEEEGDVRNLSWCVIGGLGGGRDRH
SSQSSDSHSTSVRSEVTLADPDSDSDNFSVEFEVESIASDDYNEDDASVSADDQAEDEDS
FDEDTEITEADYWRCVKCDELNPPLPRNCLRCWTLRRDWLPEELSKSASSSPKALPPKPN
DQSAANEAPVCASSIHVTLVAHERPLLNQIRKCTEPASSSSQLFPSSLDSQEPASTSPAG
DPASATPELERSVSAEWRLPDSCLDPCLICQSRPKNGCIVHGRTGHLISCYVCARKLKKR
NKLCPVCRMPIQSVILTYLS
Download sequence
Identical sequences H2T887
ENSTRUP00000020877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]