SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020935 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020935
Domain Number 1 Region: 1-442
Classification Level Classification E-value
Superfamily Sema domain 1.19e-137
Family Sema domain 0.0000000114
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000020935
Domain Number - Region: 449-479
Classification Level Classification E-value
Superfamily Plexin repeat 0.0209
Family Plexin repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020935   Gene: ENSTRUG00000008359   Transcript: ENSTRUT00000021022
Sequence length 567
Comment pep:known_by_projection scaffold:FUGU4:scaffold_186:584155:588546:1 gene:ENSTRUG00000008359 transcript:ENSTRUT00000021022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFSTFLLDRTTGMLFMGARDAILALDTNNLQQPVKKIVWDVPERKRQSCVTKGKTEVDCN
NYIRLLQFLGDGRIYVCGTYAFDPQCAFLELSTFTLERAQDGGVRMETGKGKCPFEPSQH
YTAVMADGTLYTAATSNFLGTLFDISRATGPEQGRIRTEQSINWLNDPEFVSSAFIQQSA
ESNPTGDDDKIYFFFTEVAKEYDLYTKVKVPRVARVCKSDVGGMKTLQRRWTTFLKAQLV
CEDKPSGQRYNVLTDVFTTQQTPGDPSSTHFYGLFTSQWEREELSAVCVFSLSDINKVLN
GPFKELKKTSENWINPEPVPTPRPGQCLNDALKAEGFETSLKLPDKVLTFVRDHPLMENS
VSAAPLLVRKGITYTKLAVTQAERKGAVLHLGTDRGELHRVAVVDQNTTLLQEIPLFPSQ
EPINNILLHQGRALVGSPLYLARVSAEGCGLYPSCEVCARARGLGCEWNTKEEVCKETTA
EPGSGDIVDEALRKIPMRSPGRCSPSIREMRVSLGLRLLLPCVQLSPRPCSWEHPPDRHT
RQHHSSLEMVVSEKSLGKYVCTCQEGG
Download sequence
Identical sequences H2T8E5
ENSTRUP00000020935 31033.ENSTRUP00000020935 ENSTRUP00000020935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]