SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021863 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021863
Domain Number 1 Region: 1-448
Classification Level Classification E-value
Superfamily Sema domain 1.06e-108
Family Sema domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1282-1410,1608-1765
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.57e-42
Family p120GAP domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 451-500
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000126
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 791-895
Classification Level Classification E-value
Superfamily E set domains 0.0000000000182
Family Other IPT/TIG domains 0.0072
Further Details:      
 
Domain Number 5 Region: 892-957
Classification Level Classification E-value
Superfamily E set domains 0.0000000000891
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 6 Region: 985-1080
Classification Level Classification E-value
Superfamily E set domains 0.0000611
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000021863
Domain Number - Region: 1431-1524
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0184
Family Ubiquitin-related 0.033
Further Details:      
 
Domain Number - Region: 754-786
Classification Level Classification E-value
Superfamily Plexin repeat 0.0558
Family Plexin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021863   Gene: ENSTRUG00000008707   Transcript: ENSTRUT00000021952
Sequence length 1824
Comment pep:known_by_projection scaffold:FUGU4:scaffold_21:244039:266314:-1 gene:ENSTRUG00000008707 transcript:ENSTRUT00000021952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTLINNVVADPRTGFLYVGAVNSLYQLSPDLEVQSRDETGPKRDSRLCTPPITEACEEAV
DTDNHNKLLLVHPAENTLVVCGSIFRGICSLRNLSSVEDLLYYSDTKGEKSYVASTEESV
SVVGVMSQYGKVGDSLPVFLVGKGYGSYDSAKLISTRILEDYGDWVVFDSIIEAAGVQSN
PFVLRYLHDFRFAFKDGHHVYFLFSRTLGIQDTKNYTFISRMCENDLGYFSYTELQLNCS
TTNKYNKAQAAFVATPGVLLAQNLTSTGQYEQVSPSDKVLFVTFTSDEDPSSSAMCMYPL
RFINEKLVKIIEACYSGKGVIDGKPSVYLPYLSNPDECRSSNKVSCGAEFLPSPLASKAG
FALKAEPLLERKGQLTAVAVAVEMEHTVAFVGSATGEVLKVHLSAHPEVYGRASAEVTGD
KVNKNLLFDSSLQHLYITREKRITKVPVQTCHLKTDCQSCMSLKDPYCGWCVLEGKCTRK
QECSRSSGSNAWLWSPDQKCVEIQSFNPPNLSCKKKDQVDIIIPKHPELGSSDKLYCVFE
NLTTEALFDGKTLVTCSLPDPVEIPPTPDQQDYVSVPVKILVNKNIEVTSGEYHFYNCAA
TRVCVCVCVCVCVCVCVCVCVSTHVPSIPKADVCVFTLKSNRCPQFESPEPLLIPVGFEI
PISFQGRNLDIYKGRKFTIGTELMKNIEREVTQEQGSKFTFSGYKVSIGHHIINSFPCFG
GKQSLVLCSVSNFCLPSPLPLPPVGLYNCSVGREDCSLCRHADATYQCVWCTATHMCVYQ
ELCRLSAPAQCPKPEITDIIPRFGPLNGRISVTIKGSNMGIKKEDIKKITVAGVDCAHQE
DRYSVSTSVVCEIGPAKRVPPSDLPFEPTHAGVVEVEVEGGRHGRSQVIFTYRDPKPVAV
HPAKGPAAGGTVITITGEDLDTATKEDVTVTVGGVSCEVLSFGVLITCKTGKYRGQKLPS
DLMTVTVKYGENTTKDILSAYQYSENPKVTDYNPKASFLCGGRKIVVTGNGFDLIQRATI
KVLPSTDEFSDDTSPDVARSKNDTVLQFDSPAVNSSCKALRTFLQLDNVVEKLKSFDYHP
DPSXNELLNPVKPLQXPDPPVFFRVXSSCPEEDKLILEAPSPQPKSRSKRPRRDTTNEML
ELVVKFGHGEWLVGSVCYARKDDIPLAIIIPAVIIPMIIFIAVSVYCYRRKSQQAEREYE
KVKHQLENLEESVRDRCKKEFTDLMIEMEDHTNDLSEARMPFLDYKTYTDCNFFLPSKDG
ANDAMITRKLQIPEARRAIVAQALNQFSNLLNSKTFLINFIHTLESRPDFNARARGYFAS
LLTVALHGKLEYYTDIMRTLLLELMDEHVQNKNPKLMLRRSETVVDRMLYNWMSICLYQF
LRDTAGEPLYKLFKALKHQVEKGPVDAKMKKAKYTLNDTGLLGDDVEYSVLVLVHGEGPD
VTPVKVLSCDTITQVKEKIIDQVYRNLPYSQRPKVESVALEWRPGSTGQILSDLDLTAQK
EGRWKKLNTLAHYNVRDNATLVLSRVLHTQSFYQHQDSYEESTQHTHTLTHSYFSHTSSL
SLCVMLTENSLLEEDNTFHLVRPADDIDEVKSKRGSMKDKAMTKAITEIYLTRLLSVKGT
LQQFVDDFFRSVLCSNSIVPPAVKYFFDFLDEQALKHDNVDEETLHIWKTNSLPLRFWVN
ILRNPHFIFDVHVTEVVEASLYVISQTLMDACTKTEHKLSRESPSNKLLYAKEISSYKKM
VDDYCKGIRQMVPVSDQDMNTHLAELSRQHTDKLNTQVALHQLYQYASKYYDVIIQSLDE
DPAAQNKQLTLRLQQIAAALENKV
Download sequence
Identical sequences H2TB23
ENSTRUP00000021863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]