SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021865 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021865
Domain Number 1 Region: 934-1062,1224-1381
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.02e-42
Family p120GAP domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 9-107
Classification Level Classification E-value
Superfamily Sema domain 0.00000000000000615
Family Sema domain 0.0099
Further Details:      
 
Domain Number 3 Region: 106-155
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000719
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 435-539
Classification Level Classification E-value
Superfamily E set domains 0.0000000000137
Family Other IPT/TIG domains 0.0072
Further Details:      
 
Domain Number 5 Region: 536-601
Classification Level Classification E-value
Superfamily E set domains 0.0000000000611
Family Other IPT/TIG domains 0.073
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000021865
Domain Number - Region: 629-670
Classification Level Classification E-value
Superfamily E set domains 0.000191
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.019
Further Details:      
 
Domain Number - Region: 398-430
Classification Level Classification E-value
Superfamily Plexin repeat 0.0628
Family Plexin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021865   Gene: ENSTRUG00000008707   Transcript: ENSTRUT00000021954
Sequence length 1444
Comment pep:known_by_projection scaffold:FUGU4:scaffold_21:244039:264357:-1 gene:ENSTRUG00000008707 transcript:ENSTRUT00000021954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGAEFLPSPLASKAGFALKAEPLLERKGQLTAVAVAVEMEHTVAFVGSATGEVLKVHLSA
HPEVYGRASAEVTGDKVNKNLLFDSSLQHLYITREKRITKVPVQTCHLKTDCQSCMSLKD
PYCGWCVLEGKCTRKQECSRSSGSNAWLWSPDQKCVEIQSFNPPNLSCKKKDQGLLPELS
TEIRTEALLVYLVKYCENINKFLKTPKPSFKALFQYIYMQAELEFDPCPSSHANIESIDI
SLTKVHFSCPVTVGLRHVACPKTLRAEFPVSALSSSCCSSNDPTSSPSTLLQVDIIIPKH
PELGSSDKLYCVFENLTTEALFDGKTLVTCSLPDPVEIPPTPDQQGNCTHPLRHTYMWIN
VDSSIFMYALRLKSNRCPQFESPEPLLIGLYNCSVGREDCSLCRHADATYQCVWCTATHM
CVYQELCRLSAPAQCPKPEITDIIPRFGPLNGRISVTIKGSNMGIKKEDIKKITVAGVDC
AHQEDRYSVSTSVVCEIGPAKRVPPSDLPFEPTHAGVVEVEVEGGRHGRSQVIFTYRDPK
PVAVHPAKGPAAGGTVITITGEDLDTATKEDVTVTVGGVSCEVLSFGVLITCKTGKYRGQ
KLPSDLMTVTVKYGENTTKDILSAYQYSENPKVTDYNPKASFLCGGRKIVVTGNGFDLIQ
RATIKVLPSTDEFSDDTSPDVSTSLLFPLQFVEEARSKNDTVLQFDSPAVNSSCKALRTF
LQLDNVVEKLKSFDYHPDPSXNELLKXLASSLSRKGHEDKLILEAPSPQPKSRSKRPRRD
TTNEMLELVTSIPLQVKFGHGEWLVGSVCYARKDDIPLAIIIPAVIIPMIIFIAVSVYCY
RRKSQQAEREYEKVKHQLENLEESVRDRCKKEFTDLMIEMEDHTNDLSEARMPFLDYKTY
TDCNFFLPSKDGANDAMITRKLQIPEARRAIVAQALNQFSNLLNSKTFLINFIHTLESRP
DFNARARGYFASLLTVALHGKLEYYTDIMRTLLLELMDEHVQNKNPKLMLRRSETVVDRM
LYNWMSICLYQFLRDTAGEPLYKLFKALKHQVEKGPVDAKMKKAKYTLNDTGLLGDDVEY
SVLTLQVLVHGEGPDVTPVKVLSCDTITQVKEKIIDQVYRNLPYSQRPKVESVALEWRPG
STGQILSDLDLTAQKEGRWKKLNTLAHYNFSHTSSLSLCVMLTENSLLEEDNTFHLVRPA
DDIDEVKSKRGSMKDKAMTKAITEIYLTRLLSVKGTLQQFVDDFFRSVLCSNSIVPPAVK
YFFDFLDEQALKHDNVDEETLHIWKTNSLPLRFWVNILRNPHFIFDVHVTEVVEASLYVI
SQTLMDACTKTEHKLSRESPSNKLLYAKEISSYKKMVDDYCKGIRQMVPVSDQDMNTHLA
ELSRQHTDKLNTQVALHQLYQYARSKLSRCRPQIIQSLDEDPAAQNKQLTLRLQQIAAAL
ENKV
Download sequence
Identical sequences H2TB25
ENSTRUP00000021865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]