SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000022205 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000022205
Domain Number 1 Region: 217-263
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000225
Family Plexin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000022205   Gene: ENSTRUG00000008838   Transcript: ENSTRUT00000022296
Sequence length 418
Comment pep:known_by_projection scaffold:FUGU4:scaffold_260:113993:131913:-1 gene:ENSTRUG00000008838 transcript:ENSTRUT00000022296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTDHDYYTSKTYSPTDAMSRDLWVNIDHMDKEKVKIHGILSNTHRQAARVNLSFDFPFYG
HFLREITVATGGFIYTGDVVHRMLTATQYIAPLMANFDPSVSRNSTVIYFDNGTALVVQW
DHVHLQDNYNLGSFTFQATLHNTGRIVFAYKEIPVEVSQISSVNHPVKVGLSDAFVVVHK
IQQIPNVRRRTIYEYHRVELTKTRITNSTAVEITPLPTCLQFISCSSCVSSQINFNCSWC
HRLNRCSSGFDRHRQDWVDNSCPDEHKPRVQCSKFYFGSKAAANPHVSFRPLEREILITV
SDISLLCLLTDDTKIALHLRDNQVMPANSAVDRMPGTHPLHIGLILGILLVTLIIAAGVL
VTVYVYHHPTSAASLFLIERRPSRWPAMKFRRGSGHPAYAEVEPVGQEKEGFIESEQC
Download sequence
Identical sequences H2TC13
ENSTRUP00000022205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]