SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000023599 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000023599
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-29
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 209-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000144
Family Spermadhesin, CUB domain 0.0055
Further Details:      
 
Domain Number 3 Region: 122-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 402-439
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000772
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 5 Region: 166-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 363-401
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 325-362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000023599   Gene: ENSTRUG00000009388   Transcript: ENSTRUT00000023697
Sequence length 564
Comment pep:known_by_projection scaffold:FUGU4:scaffold_92:653324:656634:-1 gene:ENSTRUG00000009388 transcript:ENSTRUT00000023697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGCSERVDLHTERRGVIYSPSWPSNYPAGVNCSWHIQGGQGEVITLSFQYFDLADSNGCK
GDWLLLTSTWNLESRLCGSVLPPPFISTRGRVWLYFHSLTNSSGQAQGFRLSYIRGRLGQ
SSCQSDEFLCGNGKCLPRSWKCNGQDECGDATDEHSCSPPPTEALPGLCPLGYLACTQAH
STRCLPASLLCNGARDCPDGSDELGCPGNTCGKHLGNFYGSFASPDFFRPARSAAAELRC
TWSLDTQDPKPIVLQVDLQLGPGDSLHVYDGLVQRAEHLLQVLSHHNNKRPAMLESSRGQ
MSVLYLAQPRSTGHGFNATYQVKGYCFPGERPCGDDQGCFFEHQRCDGYWHCPTGRDEEG
CPVCKAGEFPCDLDTLACYPASERCNNQKQCPNGSDEKNCYECQPGNFHCGTNLCIFETW
QCDGQEDCLDGSDERDCLAAMPRKVITAALIGSLVCSLLLVIALGCALKLHSLRSREYRA
FETQMTRMEAEFVQREAPPSYSQLIAQGLIPPVDDFPAYNATQASVLQNLRLAMHRQIRR
HSTRRGNPLSSHGHLWSRVFHNGR
Download sequence
Identical sequences H2TG01
ENSTRUP00000023599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]