SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000023637 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000023637
Domain Number 1 Region: 678-803,973-1115
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.02e-24
Family p120GAP domain-like 0.043
Further Details:      
 
Domain Number 2 Region: 7-88
Classification Level Classification E-value
Superfamily Sema domain 0.00000000000863
Family Sema domain 0.015
Further Details:      
 
Domain Number 3 Region: 91-127
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000301
Family Plexin repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000023637
Domain Number - Region: 379-426
Classification Level Classification E-value
Superfamily E set domains 0.0607
Family E-set domains of sugar-utilizing enzymes 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000023637   Gene: ENSTRUG00000009407   Transcript: ENSTRUT00000023735
Sequence length 1189
Comment pep:known_by_projection scaffold:FUGU4:scaffold_168:344655:355434:1 gene:ENSTRUG00000009407 transcript:ENSTRUT00000023735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITSCTIRQKHMTSVLAVRQKAWVVFFIGTEDGQLIKLAVDKRYHAACPKVLYRANDDRP
VFPKIYLDQVDHKHLYMAFSNQVKRVPVSTCSSYTTLQDCWSAQDPYCVWCSSKNSCTYE
EACGGSAWLSIPEESQHKMVSYEALTSFPPQITITVLAQVTVNQRAASNFTCRFSTNSVQ
LSCKTPLTFPQCTCTLPSIPGAGLPVVVEITFGMTRLEEHINIFNCTNIRDPPASAETGQ
YWVQTDDLCVTWSGPRDLLRLPERRVFLWQKPRGAVGSEPRRSDQSEDSGQHGLQVAGVS
RIFTQQSKLVAPTGTFEHKDTFLQRLLPSLMLRSPVWSNTGTSLTFRIPSAASKGAVQVC
VVLSDNSCHGDATITYQSLPSCSGITPKSSWVSGNRVITLTGSHLEFVDGVMHRGVPLDV
HPQINSSLQTRSQMFLFNLFPQILTYHTHESFGAPSREVLLRVVNETLPCSNITYHPDPE
FTSFTTVNIQGGVRVTMQKKADKLEIQPEELSVWGIYEGKEHPCEMETTESTNDFIICEI
QTPQTIAFSVYLSQIKFGQKTVTLKSASWVPILLVLLLIPFIIVLVAIVYCNKQKKLTAQ
MNKRMEELELDVRNDIRQGFVDLQTEKADLMENVGTIPFLDYKHFASRIFFPENDLLMKA
CIKDIGQDARQNQLDKCCQGLSKLLQDQLFLTSMVHALEEQRSFTIKDKCALASLLTVAL
HNKLSYLTDVMEALLKDLMQQNRGAQPKLLLRRTEFIVEKLLTNWMAICLYGFLRESVGQ
QLFLMVSALTQQIAKGPVDCVTEKALYTLSEDWLLWQAQDFSSLTLRFVFDLTVGNDGEV
SEPLEVKALSCDTVEQVKEKILSTFKAKFGFSYSTTFRDLCLEYEKNGSFVPLQEVDASS
EVIGDVTMLNTLKHYKVPDGATVKVLSALLICLHSDDENFSGKYFHLIDPDVDEDKRKNP
ERKKLKLKEVHLTKLLSTKVALHSFVENLFRSIWGTPYTKAPHAIKYFFDFLDRQADAMR
ITEPDVLHIWKTNSLPLRFWVNIIKNPQFMFDMEKTPNLDGCLSVIAQAFMDSFSLSETQ
LGKYAPTNKLLYARDIPIFKQEVKAYYKQVREQPPVTASEFKDFLQQESKKHENEFDDSV
ALRELYKFIRQYFTEIKEKLDKNGAPSELVEQLHHVRNSFDGLQSCSWN
Download sequence
Identical sequences H2TG39
ENSTRUP00000023637 ENSTRUP00000023637 31033.ENSTRUP00000023637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]