SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024120 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTRUP00000024120
Domain Number - Region: 54-130,157-177
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00471
Family FCH domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024120   Gene: ENSTRUG00000009601   Transcript: ENSTRUT00000024219
Sequence length 205
Comment pep:known_by_projection scaffold:FUGU4:scaffold_33:632627:634501:1 gene:ENSTRUG00000009601 transcript:ENSTRUT00000024219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVTDDEVIRKRLLIDGDGAGDDRRINLLLKTFTKWCNSPGSPEEGFTQYQRMLSTLAQ
CEFSLGKTLMVYDMNLREMENYEKIYTNIEQNITSAHEKIAECKKEIQKAKRIRKNRQEY
DALAKVIQQHPDRHDTLKQLEALDKELQHLSHIKENVDAKLELRKKQFHVLLTTIQELQQ
TLENDEKSEDDNNQAEASTRSKTSP
Download sequence
Identical sequences H2THH0
ENSTRUP00000024120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]