SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024282 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024282
Domain Number 1 Region: 45-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-33
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 167-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-20
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 3 Region: 289-325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024282   Gene: ENSTRUG00000009667   Transcript: ENSTRUT00000024381
Sequence length 330
Comment pep:known_by_projection scaffold:FUGU4:scaffold_92:673256:682389:-1 gene:ENSTRUG00000009667 transcript:ENSTRUT00000024381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICQTHPCSLIQSWILFFLIEEGFALAQRTKDSLIEHGSQSPNQNDCGTWVRNINGGVFTS
PNYPNTYPPNKECVYILEALPRQRIQLAFDKNYYVEPSFECRFDHIEIRDGPFGFSPLID
RFCGGKNPGLVTSTGRFMWIKFTSDEELEGLGFRIKYTFIAAPLLCLSSDCQFEISGWDG
VIRSSQVEDEERVKPGDALDCIWTIRAPPQSKIYLRFMEYQMEHSNECKKNFVAVYDGSS
AIENLKAKFCSTVANDVMLDNGVGVVRMWADEKSRLSRFRMLFTSFVDPPCSANTFFCHS
NMCINNSLVCNGVQNCVYPWDENHCKGNKK
Download sequence
Identical sequences H2THY2
ENSTRUP00000024282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]