SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000024900 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000024900
Domain Number 1 Region: 233-323
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 5.01e-29
Family SWIB/MDM2 domain 0.0000174
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000024900
Domain Number - Region: 14-82
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00785
Family beta-sandwich domain of Sec23/24 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000024900   Gene: ENSTRUG00000009910   Transcript: ENSTRUT00000025003
Sequence length 463
Comment pep:known_by_projection scaffold:FUGU4:scaffold_223:416228:422946:1 gene:ENSTRUG00000009910 transcript:ENSTRUT00000025003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPGMPSGARMPHQGAPMGPPGPPYGGSPAVRPGLPTPVIEASRKRPAPSQQVQQQQQQQQ
QTVQNRARNAKRRKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALK
RPMKQKRKLRLYISNTFNPARPDADDSDGSIASWELRVEGKLLDDQRASERRTGKQKKKF
SSFFKSLVIELDKDLYGPDNHLVEQWHRTPTTQETDGFQVKRPGDVSVRCTLLLMLDYQP
PQFKLDPRLARLLGIHTQTRSCIIQALWQYIKTNKLQDSHDKEYINCDKYFQQIFDCPRL
KFSEIPQRLTNLLLPPDPIVINHIISVDPNDHKKTACYDIDVEVEDPLKSQMSSFLLSTA
NQQEIASLDNKIHETIESINQLKIQRDFMLSFSRDPKGYIQDWLKSQSRDLKLMTDVVGN
PEEERRAAFYHEPWSQEAVSRYFYCKIQQRRQELEQALAVRTT
Download sequence
Identical sequences H2TJP6
ENSTRUP00000024900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]