SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025240 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025240
Domain Number 1 Region: 40-511
Classification Level Classification E-value
Superfamily Sema domain 3.53e-118
Family Sema domain 0.00000185
Further Details:      
 
Domain Number 2 Region: 1077-1348
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-77
Family Protein kinases, catalytic subunit 0.00000000635
Further Details:      
 
Domain Number 3 Region: 657-749
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000377
Family E-set domains of sugar-utilizing enzymes 0.066
Further Details:      
 
Domain Number 4 Region: 514-559
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000549
Family Plexin repeat 0.00089
Further Details:      
 
Domain Number 5 Region: 557-620
Classification Level Classification E-value
Superfamily E set domains 0.0000000743
Family Cellulosomal scaffoldin protein CipC, module x2.1 0.093
Further Details:      
 
Domain Number 6 Region: 749-824
Classification Level Classification E-value
Superfamily E set domains 0.0000124
Family Other IPT/TIG domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025240   Gene: ENSTRUG00000010034   Transcript: ENSTRUT00000025343
Sequence length 1377
Comment pep:known_by_projection scaffold:FUGU4:scaffold_56:472445:479979:1 gene:ENSTRUG00000010034 transcript:ENSTRUT00000025343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEMVTWTALLTICIWILTQTASGQHACASGSRTLVDFTVKYSLPHFQTSKPVQNIAVNWD
SQQKEIYIGCQNAIKAVSGTLEEMWEVKTGPVGSPDCETCKLCDVEADPEDPVDTDSEVL
VLDPAGILLPYLYVCGSTQHGICYFIDIESPEHAPQCLYKKQRNSPTRCPDCLASPLGTK
VSIIEDGSTTYFFVAAAVDDRVAQRYPRRSISVMRPLSTEDGFEMVTDGLTVLPSLRSTY
KIDYIHSFATKEYVYFLSLQRENPSNSNSPLQTRLGRLPISIREVWMYREVVLECHFNPK
RRRRGDFRGIVYNGLQAAHFGRAGKDLAEELRVDEQEDILYGVFAVVNELGETQRNSALC
AFPLSKVNHAIDEGVEACCSLHIITLPGSEGGNCLQCGSRTGKCIHQSSEDKYTCRSKPT
LVAQPHYRLDLFNRKMRDVLFTTVLVTTTGNHTLGHFGTSDGRILQVILSLYRPIVFANY
SLGDGEVSRTAAVYSEDWLLFVVGNKMFKVPSLGPGCAHFRTCSMCLMAPRFMNCGWCSG
VCSRQHQCDMQWEKDSCAPVITEFSPKVAPVGGDTEVTLCGWEFQSPLRPAIINGKTHSI
MVGSTVCIVLPEKSSSEKIQEKNKPGQDLKIVLKVHEGEVEGRYSIEGTAQIQGFSFVEP
SITDIQPDYGPAFGGTTVTLTGRHLDSGFQRDVFFGEKQCRILSVSGGTDASSSIVCLPA
VAEDVGSVPVKVLIDSFPVTATKMFFYKRNPVITLVEPQCSLHRQHSGSRLVIQGQNLDS
AHKTVVEYVSKDANLRPLQQVCNGSTNATHMECWAPALPEEMPDEKETGQIYIHMEEQLK
VIPFENEDRVLLLKPGENEVSLHHRNLNTVSLCMKINMTVGGVDCNAEVLSNELTCRIPK
GLVIPTGGLPVKVRDTQVDQVSIGGEVYDVGTVGIDDSNAAVSIAVITLSIVGALVLGAV
MALAVMFHVRKKNQKRAHYQLISRARPSSEHRAPFIDEALTCPLQRRGGFFPHECLRFPP
VTVDLSSPTSGSGGMAFQGLLYAASSDHLSIPLLPRDNISMVSLNPDLLEEVKNVLIPAD
MLRIEDRQVIGKGHFGTVYHGYLIDSNKQETHCAVKSLNRITDLKDVDHFLREGLIMKGF
DHPNILSLLGIMLPKEGLPLVVLPYMKHGDVRHFIRSEKRNPTVKDLIGFGLQVAKGMEY
LAQKKFVHRDLAARNCMLDETYTVKVADFGMARDIYDKEYYSIQDHKQVKLPVKWMAIES
LQTQKFTSKSDVWSYGILMWELLTRGASPYPDVDPYDITNYLLKGRRLPQPQFCPNTLYS
IMLSCWDPEPDFRPSFSSLASDVQHILLCLQGEHYISLKVNYVNLDQPRPYPSLTGS
Download sequence
Identical sequences H2TKN6
ENSTRUP00000025240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]