SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025244 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025244
Domain Number 1 Region: 38-506
Classification Level Classification E-value
Superfamily Sema domain 6.8e-118
Family Sema domain 0.00000234
Further Details:      
 
Domain Number 2 Region: 1060-1331
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-77
Family Protein kinases, catalytic subunit 0.00000000635
Further Details:      
 
Domain Number 3 Region: 646-738
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000377
Family E-set domains of sugar-utilizing enzymes 0.066
Further Details:      
 
Domain Number 4 Region: 509-554
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000549
Family Plexin repeat 0.00089
Further Details:      
 
Domain Number 5 Region: 552-628
Classification Level Classification E-value
Superfamily E set domains 0.0000000000388
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number 6 Region: 738-840
Classification Level Classification E-value
Superfamily E set domains 0.000000187
Family Other IPT/TIG domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025244   Gene: ENSTRUG00000010034   Transcript: ENSTRUT00000025347
Sequence length 1368
Comment pep:known_by_projection scaffold:FUGU4:scaffold_56:472451:480003:1 gene:ENSTRUG00000010034 transcript:ENSTRUT00000025347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTWTALLTICIWILTQTASGQHACASGSRTLVDFTVKYSLPHFQTSKPVQNIAVNWDSQ
QKEIYIGCQNAIKAVSGTLEEMWEVKTGPVGSPDCETCKLCDVEADPEDPVDTDSEVLVL
DPAGILLPYLYVCGSTQHGICYFIDIESPEHAPQCLYKKQRNSPTRCPDCLASPLGTKVS
IIEDGSTTYFFVAAAVDDRVAQRYPRRSISVMRPLSTEDGFEMVTDGLTVLPSLRSTYKI
DYIHSFATKEYVYFLSLQRENPSNSNSPLQTRLGRLPISIREVWMYREVVLECHFNPKRR
RRGDFRGIVYNGLQAAHFGRAGKDLAEELRVDEQEDILYGVFAVVNELGETQRNSALCAF
PLSKVNHAIDEGVEACCRSVWVPNREMHSSNMYFKIKAQGSKSSEDKYTCRSKPTLVAQP
HYRLDLFNRKMRDVLFTTVLVTTTGNHTLGHFGTSDGRILQVILSLYRPIVFANYSLGDG
EVSRTAAVYSEDWLLFVVGNKMFKVPSLGPGCAHFRTCSMCLMAPRFMNCGWCSGVCSRQ
HQCDMQWEKDSCAPVITEFSPKVAPVGGDTEVTLCGWEFQSPLRPAIINGKTHSIMVGST
VCIVLPEKSSSEKLVCRIQEKNKPGQDLKIVLKVHEGTAQIQGFSFVEPSITDIQPDYGP
AFGGTTVTLTGRHLDSGFQRDVFFGEKQCRILSVSGGTDASSSIVCLPAVAEDVGSVPVK
VLIDSFPVTATKMFFYKRNPVITLVEPQCSLHRQHSGSRLVIQGQNLDSAHKTVVEYVSK
DANLRPLQQVCNGSTNATHMECWAPALPEEMPDEKETGQIYIHMEEQLKVWSSRFEYHGN
VKVIPFENEDRVLLLKPGENEVSLHHRNLNTVSLCMKINMTVGGVDCNAEVLSNELTCRI
PKGLVIPTGGLPVKVSIGGEVYDVGTVGIDDSNAAVSIAVITLSIVGALVLGAVMALAVM
FHVRKKKKVYRRGSHLPAPAPRRIFPPREITDAVSQECLRFPPVTVDLSSPTSGSGGMAF
QGLLYAASSDHLSIPLLPRDNISMVSLNPDLLEEVKNVLIPADMLRIEDRQVIGKGHFGT
VYHGYLIDSNKQETHCAVKSLNRITDLKDVDHFLREGLIMKGFDHPNILSLLGIMLPKEG
LPLVVLPYMKHGDVRHFIRSEKRNPTVKDLIGFGLQVAKGMEYLAQKKFVHRDLAARNCM
LDETYTVKVADFGMARDIYDKEYYSIQDHKQVKLPVKWMAIESLQTQKFTSKSDVWSYGI
LMWELLTRGASPYPDVDPYDITNYLLKGRRLPQPQFCPNTLYSIMLSCWDPEPDFRPSFS
SLASDVQHILLCLQGEHYISLKVNYVNLDQPRPYPSLTGSADEAEASD
Download sequence
Identical sequences H2TKP0
ENSTRUP00000025244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]