SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025245 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025245
Domain Number 1 Region: 6-477
Classification Level Classification E-value
Superfamily Sema domain 1.06e-120
Family Sema domain 0.00000271
Further Details:      
 
Domain Number 2 Region: 1045-1316
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-77
Family Protein kinases, catalytic subunit 0.00000000635
Further Details:      
 
Domain Number 3 Region: 627-719
Classification Level Classification E-value
Superfamily E set domains 0.000000000000034
Family E-set domains of sugar-utilizing enzymes 0.066
Further Details:      
 
Domain Number 4 Region: 480-525
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000549
Family Plexin repeat 0.00089
Further Details:      
 
Domain Number 5 Region: 523-599
Classification Level Classification E-value
Superfamily E set domains 0.0000000000433
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number 6 Region: 719-821
Classification Level Classification E-value
Superfamily E set domains 0.000000187
Family Other IPT/TIG domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025245   Gene: ENSTRUG00000010034   Transcript: ENSTRUT00000025348
Sequence length 1360
Comment pep:known_by_projection scaffold:FUGU4:scaffold_56:472547:480324:1 gene:ENSTRUG00000010034 transcript:ENSTRUT00000025348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDFTVKYSLPHFQTSKPVQNIAVNWDSQQKEIYIGCQNAIKAVSGTLEEMWEVKTGPVGS
PDCETCKLCDVEADPEDPVDTDSEVLVLDPAGILLPYLYVCGSTQHGICYFIDIESPEHA
PQCLYKKQRNSPTRCPDCLASPLGTKVSIIEDGSTTYFFVAAAVDDRVAQRYPRRSISVM
RPLSTEDGFEMVTDGLTVLPSLRSTYKIDYIHSFATKEYVYFLSLQRENPSNSNSPLQTR
LGRLPISIREVWMYREVVLECHFNPKRRRRGDFRGIVYNGLQAAHFGRAGKDLAEELRVD
EQEDILYGVFAVVNELGETQRNSALCAFPLSKVNHAIDEGVEACCRSGTEQLSRGLGHFQ
PLESCPHEVVFVQSSEDKYTCRSKPTLVAQPHYRLDLFNRKMRDVLFTTVLVTTTGNHTL
GHFGTSDGRILQVILSLYRPIVFANYSLGDGEVSRTAAVYSEDWLLFVVGNKMFKVPSLG
PGCAHFRTCSMCLMAPRFMNCGWCSGVCSRQHQCDMQWEKDSCAPVITEFSPKVAPVGGD
TEVTLCGWEFQSPLRPAIINGKTHSIMVGSTVCIVLPEKSSSEKLVCRIQEKNKPGQDLK
IVLKVHEGEVEGRYSIEGTAQIQGFSFVEPSITDIQPDYGPAFGGTTVTLTGRHLDSGFQ
RDVFFGEKQCRILSVSGGTDASSSIVCLPAVAEDVGSVPVKVLIDSFPVTATKMFFYKRN
PVITLVEPQCSLHRQHSGSRLVIQGQNLDSAHKTVVEYVSKDANLRPLQQVCNGSTNATH
MECWAPALPEEMPDEKETGQIYIHMEEQLKVWSSRFEYHGNVKVIPFENEDRVLLLKPGE
NEVSLHINMTVGGVDCNAEVLSNELTCRIPKGLVIPTGGLPVKVRDTQVDQIRRNVLIGV
IQLITLSIVGALVLGAVMALAVMFHVRKKKKAKNVPITSSFLVPVPPANIEHRLSTRLSL
ARSSAAADFSPTGDYRRVISDECLRFPPVTVDLSSPTSGSGGMAFQGLLYAASSDHLSIP
LLPRDNISMVSLNPDLLEEVKNVLIPADMLRIEDRQVIGKGHFGTVYHGYLIDSNKQETH
CAVKSLNRITDLKDVDHFLREGLIMKGFDHPNILSLLGIMLPKEGLPLVVLPYMKHGDVR
HFIRSEKRNPTVKDLIGFGLQVAKGMEYLAQKKFVHRDLAARNCMLDETYTVKVADFGMA
RDIYDKEYYSIQDHKQVKLPVKWMAIESLQTQKFTSKSDVWSYGILMWELLTRGASPYPD
VDPYDITNYLLKGRRLPQPQFCPNTLYSIMLSCWDPEPDFRPSFSSLASDVQHILLCLQG
EHYISLKVNYVNLDQPRPYPSLTGSADEAEASDLDSDDCT
Download sequence
Identical sequences H2TKP1
ENSTRUP00000025245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]