SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025345 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025345
Domain Number 1 Region: 5-455
Classification Level Classification E-value
Superfamily Sema domain 1.1e-140
Family Sema domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 560-610
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000327
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 451-501
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000227
Family Plexin repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 614-653
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000445
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 504-557
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000445
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025345   Gene: ENSTRUG00000010074   Transcript: ENSTRUT00000025448
Sequence length 679
Comment pep:known_by_projection scaffold:FUGU4:scaffold_152:551400:593060:-1 gene:ENSTRUG00000010074 transcript:ENSTRUT00000025448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVLSVAEMESWIFRFKAEGTVDYSQLTFDPGQNELIVGARNHLFRLNLEDLTLIQEAEWH
CDEFTKGACFSRGKSEEECQNYIRVLLVNGNRLFTCGTNAFTPICTNRTLTNLTEIHDQI
SGMARCPYNPLHNSTALITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLN
EPNFVASYDIGNFTYFFFRENAVEHDCGRMVFSRAGRVCKNDIGGRFLLEDTWTTFMKAR
LNCSRPGEIPFNYNELQGTFYLPELELLYGIFTTNVNSIAASAVCTFNLSAISQVFKGPF
KYQENSRSAWLPYPNPNPDFQCGTIDSGSYVNLTERNLQDAQKFLLMHEVVQPVDPVPYF
MEDGVRFTHVAVDVVQGKDVLFHIIFLATDYGTIRKVLSPLNHSTGSCLLEEIELFPPRK
RQPIRSVLILHSRSELYVGVRDQVIKIPLKRCSYHKSREACVGARDPYCGWDLLLKKCTT
LEESVRMSQWEQSITKCPIRNVTVDGAFGAWSGWSACSHNDGGSTGSCLCRTRACDSPAP
QCGGQQCQGINVEVANCSRNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPTPRHGGRVCV
GQNREERYCNEHLPCPPHVYWSAWSAWERCTVACGGGIQSRRRTCENGDDCPGCGQPSQN
LSPIPHSIMIHPTHALSTS
Download sequence
Identical sequences H2TKZ0
ENSTRUP00000025345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]