SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026517 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026517
Domain Number 1 Region: 399-572
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-49
Family SPRY domain 0.00052
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 149-214
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000029
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000026517
Domain Number - Region: 270-347
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0314
Family EspA-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026517   Gene: ENSTRUG00000010509   Transcript: ENSTRUT00000026624
Sequence length 577
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:360777:365601:1 gene:ENSTRUG00000010509 transcript:ENSTRUT00000026624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSKLWTNEQFNCPVCLDLPNDPVTIPCGHSYCMACIKDFWSNDEPKGIYSCPQCRQVFC
PMPPLSKNTMLADAVEQLRKGALKADVRDSIRSARGGTTSSSRPKAVACDMCKGEQREAV
KSCLVCMSSYCEAHLKPHQTKKALKQHELVAPTSNLAEKICTQHKYLQEFFCRQCKTFIC
WLCTSNQHKGHESVSTKVERLEKQKVLSDLQAETQQRLKEREQELKNLKKVMEVTKRSAI
KVHSDTEQTLKELQRSVERLQELMEEVLDQANLEKMSQAQEVADSLEAEIKVLKKRDSDM
KDLAQCEDHIHYLQTCESMNSPLDTGDLPAVAVNLEASFEPVRDTVLDLREQVEDLCNQE
LGKFTKQRPHQLTQTSRTTEKRVREINIDSLQAPEPRSREEFLQYSVTLTLDPNTAHRRL
GISEGNTKATLQGAAQPYPDTPERFDGWTQVMCQGPMYAQRCYWEVEWRGRGSSIGVAYG
AMSRKGSDAMSGLGYNARSWTLELSDTCCAALHDNQKRDIPVTYSPRLGIYLDLSSGMLA
FYSVADTMTHLHTFHANFTQPLYAVFGVGSGVGVGLD
Download sequence
Identical sequences H2TPB1
ENSTRUP00000026517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]