SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026520 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026520
Domain Number 1 Region: 362-528
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-48
Family SPRY domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1-72
Classification Level Classification E-value
Superfamily RING/U-box 2.31e-18
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 128-190
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000687
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026520   Gene: ENSTRUG00000010509   Transcript: ENSTRUT00000026627
Sequence length 538
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:360801:365619:1 gene:ENSTRUG00000010509 transcript:ENSTRUT00000026627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQFNCPVCLDLPNDPVTIPCGHSYCMACIKDFWSNDEPKGIYSCPQCRQVFCPMPPLSKN
TMLADAVEQLRSARGGTTSSSRPKAVACDMCKGEQREAVKSCLVCMSSYCEAHLKPHQTK
KALKQHELVAPTSNLAEKICTQHKYLQEFFCRQCKTFICWLCTSNQHKGHESVSTKVERL
EKQSFILQKSQILTNPRTIIVSFPAQRSAIKVHSDTEQTLKELQRSVERLQELMEEVLDQ
ANLEKMSQAQEVADSLEAEIKVLKKRDSDMKDLAQCRSDQVWLRVTPILVHQPITALMQE
KTHVKLHTAPTLPLNEPLRTVRMTKLGLGWVLMSNYCKSQKNDAKSILNQNVEYKSLGQN
SVTLTLDPNTAHRRLGISEGNTKATLQGAAQPYPDTPERFDGWTQVMCQGPMYAQRCYWE
VEWRGRGSSIGVAYGAMSRKGSDAMSGLGYNARSWTLELSDTCCAALHDNQKRDIPVTYS
PRLGIYLDLSSGMLAFYSVADTMTHLHTFHANFTQPLYAVFGVGSGVGVGLDFALGKF
Download sequence
Identical sequences H2TPB4
ENSTRUP00000026520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]