SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027037 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027037
Domain Number 1 Region: 7-467
Classification Level Classification E-value
Superfamily Sema domain 2.62e-101
Family Sema domain 0.00068
Further Details:      
 
Domain Number 2 Region: 1297-1421,1587-1771
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.71e-34
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 787-878
Classification Level Classification E-value
Superfamily E set domains 0.000000000000496
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 884-958
Classification Level Classification E-value
Superfamily E set domains 0.00000000000582
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 5 Region: 469-509
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000732
Family Plexin repeat 0.0036
Further Details:      
 
Domain Number 6 Region: 970-1005
Classification Level Classification E-value
Superfamily E set domains 0.0000216
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000027037
Domain Number - Region: 744-782
Classification Level Classification E-value
Superfamily Plexin repeat 0.0262
Family Plexin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027037   Gene: ENSTRUG00000010718   Transcript: ENSTRUT00000027146
Sequence length 1811
Comment pep:known_by_projection scaffold:FUGU4:scaffold_180:453955:507377:-1 gene:ENSTRUG00000010718 transcript:ENSTRUT00000027146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGSRPEAFPSPTQTNNFAVDPNSRKVYLATVNTIYQLNGTLSAEVEMRTGPVEDNLLCHA
PQLPQAPCEHPKSLTDNYNKLLELDREQGVVVVCGSVYQGFCELRKMENISQIAVEFPPQ
GEKTVFPSMLNIAANHPNASTVGLIFKSGGNTRLLVGATNTPEIAIRSLNVKDLPRLFTY
DINPSEDNVFKIKQEVKSKNKLNFVHAFTQKTYSYIAFNNDAKMGHKESQPNSILARICL
DTENPRKPSGPESRKLTESYIQMPLQCGFNGNIYNRLLSVYPADIPTEDGREPESHLFGV
FSKGDRKSALCAFKFSDIEEEIRQGREKCSNSPSSDVQVLDSVIQGSGAACVQKGKLTLQ
LEQLNCGAAHLQHPLALRRPLRALPLVEYPALTSVSVDCVHNHTVVFLGTSNGRLRKLTF
LANMTLANQWTLKLPASEAVHHLMTFDPSDSNYLYLMTSHHMLRVKVAQCDQWRSCGDCL
GARDAHCGWCTLENRCRQPPPRSRRRVNGKWSHLWRREEDVGILINGSVPDLLGSRVECE
YGPGVSTSATVHLDSGPAQIQTCPLLPRENYQSILPDTDHQAVSVAIKVNGTSVVSGSFI
IYDCERTGAIHPKTSCVSCLSARWKCYWDQENHLCVSNKDESNLHLIESATSCPSLLASE
VPPAPSGTAQDFTLSLRNVQEVQQTTLSRIDMPGLGPECVFLHFGVDRSKMPTHTSMPGH
EAQPASLMTNTFSAPVALHISLEVYNCKVGSSDCSQCWGREDQGHLCGWCENSCKPRDDC
QPIVEQCASPEIHKIFPLRGPVEGGTLLTVQGRNLGRRAEAVKVSIGDVPCSLLPDRYTV
SLELVCITGWSADEKTDIVQVDVEQSGTGTSKESFSYLLPKLLYMEPNKGYHAGGTKVTI
TGEHLDIGSQVRVMVNSTHECVITEKTDNVIECTMPAVTQAHVSSVSVCVEFENLPCQRD
DLSTTYTYKKNPTIFFIEPTKSYLSGGRTITVTGQGFDLVQSAVMQTRAPRLRTARKRKM
KKEKMATLEYVEDPQFFTANKEKLIKHHPGEPLTLIINSLGRCFPLMEEPKVFCRETAER
IKGNIEKRDCCLINAAETDQIYGQGENIVNVKAISGRTSCVFSTFVHFRTDKVRLEDGKR
EQRDSADHSESSQVQVGNFRHIIAKVQLGGSELAIVVSIVVCCVLLLLCTVALVVYCTKS
RRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKQFVTR
TFFPKVRENFFSPCDTNLNGNLIFINTTKPNVEEGITLFSTLLNNKHFLVTFVHALEQQK
DFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKML
TNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENVEAR
PQNINVSFQGCGMDSLSVRVMHTDTVCQVKEKTIEAFYKNLPFSQWPRAEDVDLEWLDSG
ANSKLLQDLDNSSVMEDGRKKLNTVFHYQIPEGASLAMSLKDKKENTLGRVKDLDTEKYV
HLVLPHDELMETRKSHRHSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFQAILSIPPDRPP
LAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHMDAC
LSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYKKRVQLYYQQIQEMSPLSEQEMN
AHLAEESRKYRNEFNTNLALTEIYKYAKRYRNQVVSALESNPTARRTQLHHKFEQVIALV
EDNIYECCSEA
Download sequence
Identical sequences H2TQT0
ENSTRUP00000027037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]