SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027038 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027038
Domain Number 1 Region: 29-514
Classification Level Classification E-value
Superfamily Sema domain 6.93e-103
Family Sema domain 0.00074
Further Details:      
 
Domain Number 2 Region: 1390-1514,1680-1864
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.86e-34
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 859-950
Classification Level Classification E-value
Superfamily E set domains 0.000000000000535
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 956-1030
Classification Level Classification E-value
Superfamily E set domains 0.0000000000057
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 5 Region: 1042-1121
Classification Level Classification E-value
Superfamily E set domains 0.0000000000196
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 6 Region: 516-569
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000192
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000027038
Domain Number - Region: 823-855
Classification Level Classification E-value
Superfamily Plexin repeat 0.0288
Family Plexin repeat 0.0046
Further Details:      
 
Domain Number - Region: 1187-1235
Classification Level Classification E-value
Superfamily E set domains 0.0962
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027038   Gene: ENSTRUG00000010718   Transcript: ENSTRUT00000027147
Sequence length 1904
Comment pep:known_by_projection scaffold:FUGU4:scaffold_180:453955:507353:-1 gene:ENSTRUG00000010718 transcript:ENSTRUT00000027147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSIEIAVLILGVLVLEARRSASALHIQQAFPSPTQTNNFAVDPNSRKVYLATVNTIYQ
LNGTLSAEVEMRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLELDREQGVVVVCGS
VYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSGGNTRLLV
GATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNVKDLPRLFTYDINPSEDNVFKIKQE
VKSKNKLNFVHAFTQKTYSYIAFNNDAKMGHKESQPNSILARICLDTENPRKPSGPESRK
LTESYIQMPLQCGFNGNIYNRLLSVYPADIPTEDGREPESHLFGVFSKGDRKSALCAFKF
SDIEEEIRQGREKCSNSPSSDVQVLDSVIQGSGAACVQKGKLTFQLQLEQLNCGAAHLQH
PLALRRPLRALPLVEYPALTSVSVDCVHNHTVVFLGTSNGRLRKLTFLANMTLANQWTLK
LPASEAVHHLMTFDPSDSNYLYLMTSHHMLRVKVAQCDQWRSCGDCLGARDAHCGWCTLE
NRCSIQKECALGLLARSWISMGEGPQQCPSMTLTPPEISVSADIKDVGILINGSVPDLLG
SRVECEYGPGVSTSATVHLDSGPAQIQTCPLLPRENYQSILPDTDHQAVSVAIKVNGTSV
VSGSFIIYDCERTGAIHPKTSCVSCLSARWKCYWDQENHLCVSNKDESNLHLIESATSCP
SLLASEVPPAPSGTAQDFTLSLRNVQEGEELECDFGTEQRYEATWVNSSVVKCSGITLFT
YHRSQIYHLNLRRKRFYSGRGEDVFVDSPQPVKVEVYNCKVGSSDCSQCWGREDQGHLCG
WCENSCKPRDDCQPIVEQCASPEIHKIFPLRGPVEGGTLLTVQGRNLGRRAEAVKVSIGD
VPCSLLPDRYTVSLELVCITGWSADEKTDIVQVDVEQSGTGTSKESFSYLLPKLLYMEPN
KGYHAGGTKVTITGEHLDIGSQVRVMVNSTHECVITEKTDNVIECTMPAVTQAHVSSVSV
CVEFENLPCQRDDLSTTYTYKKNPTIFFIEPTKSYLSGGRTITVTGQGFDLVQSAVMQVE
GIGQTMCSVISNSTIHCPSHSSSESQQTSVRFFLNGVLYTDESSSSSDSEEEEDEEGEDG
DPNKDHFLLEYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPSDLDLVPEEYSVMIGSYP
CNISFHNDQLFHCTINGLLGSSERELPVTVQVGNFRHIIAKVQLGGSELAIVVSIVVCCV
LLLLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELN
RSQGIPFLEYKQFVTRTFFPKMCSDYEKSLVLHAYENDGMGPRALPETHPLLQDWQATNT
TKPNVEEGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTS
IMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAI
KQQINKGSIDAITGKARYTLNEEWLLRENVEARPQNINVSFQGCGMDSLSVRVMHTDTVC
QVKEKTIEAFYKNLPFSQWPRAEDVDLEWLDSGANSKLLQDLDNSSVMEDGRKKLNTVFH
YQIPEGASLAMSLKDKKENTLGRVKDLDTEKYVHLVLPHDELMETRKSHRHSHRKKVLPE
IYLTRLLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHI
WKTNSLPLRFWVNILKNPQFVFDIEKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNK
LLYAKEIPEYKKRVQLYYQQIQEMSPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYA
KRYRNQVVSALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences H2TQT1
ENSTRUP00000027038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]