SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027039 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027039
Domain Number 1 Region: 29-515
Classification Level Classification E-value
Superfamily Sema domain 2.22e-100
Family Sema domain 0.00061
Further Details:      
 
Domain Number 2 Region: 1355-1479,1668-1852
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-34
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 857-948
Classification Level Classification E-value
Superfamily E set domains 0.000000000000535
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 517-570
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000192
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 947-1018
Classification Level Classification E-value
Superfamily E set domains 0.000000000644
Family Other IPT/TIG domains 0.087
Further Details:      
 
Domain Number 6 Region: 1038-1103
Classification Level Classification E-value
Superfamily E set domains 0.00000000268
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000027039
Domain Number - Region: 821-853
Classification Level Classification E-value
Superfamily Plexin repeat 0.0288
Family Plexin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027039   Gene: ENSTRUG00000010718   Transcript: ENSTRUT00000027148
Sequence length 1892
Comment pep:known_by_projection scaffold:FUGU4:scaffold_180:453955:507353:-1 gene:ENSTRUG00000010718 transcript:ENSTRUT00000027148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSIEIAVLILGVLVLEARRSASALHIQQAFPSPTQTNNFAVDPNSRKVYLATVNTIYQ
LNGTLSAEVEMRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLELDREQGVVVVCGS
VYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSGGNTRLLV
GATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNVKDLPRLFTYDINPSEDNVFKIKQE
VKSKNKLNFVHAFTQKTYSYIAFNNDAKMGHKESQPNSILARICLDTENPRKPSGPESRK
LTESYIQMPLQCGFNGNIYNRLLSVYPADIPTEDGREPESHLFGVFSKGDRKSALCAFKF
SDIEEEIRQGREKCSNSPSSDVQVLDSVIQGSGAACVQKGKLTLQLEQLNCGAAHLQHPL
ALRRPLRALPLVEYPALTSVSVDCVHNHTVVFLGTSNGRLRKVRQDSRSARQAVQDGRMS
PYKPLFPIVPDLFISLNDSNYLYLMTSHHMLRVKVAQCDQWRSCGDCLGARDAHCGWCTL
ENRCSIQKECALGLLARSWISMGEGPQQCPSMTLTPPEISVSADIKDVGILINGSVPDLL
GSRVECEYGPGVSTSATVHLDSGPAQIQTCPLLSFWFPGLSLAVPKQASSKKTDKWKRGC
STRPHFRNEPHNRCVSCLSARWKCYWDQENHLCVSNKDESNLHLIESATSCPSLLASEVP
PAPSGTAQDFTLSLRNVQEPHSSQQGEELECDFGTEQRYEATWVNSSVVKCSGITLFTYH
RSQIYHLNLRRKRFYSGRGEDVFVDSPQPVKVEVYNCKVGSSDCSQCWGREDQGHLCGWC
ENSCKPRDDCQPIVEQCASPEIHKIFPLRGPVEGGTLLTVQGRNLGRRAEAVKVSIGDVP
CSLLPDRYTVSLELVCITGWSADEKTDIVQVDVEQSGTGTSKESFSYLLPKLLYMEPNKG
YHAGGTKVTITGEHLDIGSQVRVMVNSTHEFHRKTDNVIECTMPAVTQAHVSSVSVCVEF
ENLPCQRDDLSTTYTYKKNPTIFFIEPTKSYLSGGRTITVTGQGFDLVQSAVMQVEGIGQ
TVSNQMCSVISNSTIHCPSHSSTECFPTAEPISRRKEGFYFNRDKKDLMCLLNFCAFSYS
FKPTAKFPTMQPDSPFHQILPACVSTHSPCDDITAAREQEYSVMIGSYPCNISFHNDQLF
HCTINGLLGSSERELPVTVQVGNFRHIIAKVQLGGSELAIVVSIVVCCVLLLLCTVALVV
YCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYK
QFVTRTFFPKVKTHPLLQDWQATNTTKPNVEEGITLFSTLLNNKHFLVTFVHALEQQKDF
AVRDRCSLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTN
WMSICMYSYLKETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENVEARPQ
NINVSFQGCGMDSLSVRVMHTDTVCQVKEKTIEAFYKNLPFSQWPRAEDVDLEWLDSGAN
SKLLQDLDNSSVMEDGRKKLNTVFHYQEWGTLMTSVIIILPVKALNYGIIPEGASLAMSL
KDKFTSAFRSIYKPEKLKPLLPQVLPHDELMETRKSHRHSHRKKVLPEIYLTRLLSTKGT
LQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFWV
NILKNPQFVFDIEKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYKK
RVQLYYQQIQEMSPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRNQVVSALE
SNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences H2TQT2
ENSTRUP00000027039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]