SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027040 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027040
Domain Number 1 Region: 2-439
Classification Level Classification E-value
Superfamily Sema domain 7.72e-95
Family Sema domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1324-1448,1638-1822
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-34
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 786-877
Classification Level Classification E-value
Superfamily E set domains 0.000000000000522
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 883-957
Classification Level Classification E-value
Superfamily E set domains 0.0000000000056
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 5 Region: 441-494
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000174
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 969-1012,1046-1084
Classification Level Classification E-value
Superfamily E set domains 0.000000000546
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000027040
Domain Number - Region: 743-781
Classification Level Classification E-value
Superfamily Plexin repeat 0.0288
Family Plexin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027040   Gene: ENSTRUG00000010718   Transcript: ENSTRUT00000027149
Sequence length 1862
Comment pep:known_by_projection scaffold:FUGU4:scaffold_180:453955:507248:-1 gene:ENSTRUG00000010718 transcript:ENSTRUT00000027149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQTNNFAVDPNSRKVYLATVNTIYQLNGTLSAEVEMRTGPVEDNLLCHAPQLPQAPCEHP
KSLTDNYNKLLELDREQGVVVVCGSVYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLN
IAANHPNASTVGLIFKSGGNTRLLVGATYTGAGTQFFPKNHSNYDINPSEDNVFKIKQEV
KSKNKLNFVHAFTQKTYSYIAFNNDAKMGHKESQPNSILARICLDTENPRKPSGPESRKL
TESYIQMPLQCGFNEDGREPESHLFGVFSKGDRKSALCAFKFSDIEEEIRQGREKCSNSP
SSDVEGMLEQHWGVTGRLIFLSHPAASPLQLEQLNCGAAHLQHPLALRRPLRALPLVEYP
ALTSVSVDCVHNHTVVFLGTSNGRLRKVFLHQTHNIGRDGVSNYVGQPLFPIVPDLFISL
NDSNYLYLMTSHHMLRVKVAQCDQWRSCGDCLGARDAHCGWCTLENRCSIQKECALGLLA
RSWISMGEGPQQCPSMTLTPPEISVSADIKLALPLLNNIPTNQLFFFSHIEIIQLESNHV
VEAFPPYLPPHNKSADHQAVSVAIKVNGTSVVSGSFIIYDCERTGAIHPKTSCVSCLSAR
WKCYWDQENHLCVSNKDESNLHLIEMINEMVSLQENNNSISQLGSGVTIRSGQVKALILH
SPSFWRGECGLCDHGGKDWFERPQMCKITVKLEKLFRRRGGLVSCQLPFFFFPQFDIPRP
FYILGGRGEDVFVDSPQPVKVEVYNCKVGSSDCSQCWGREDQGHLCGWCENSCKPRDDCQ
PIVEQCASPEIHKIFPLRGPVEGGTLLTVQGRNLGRRAEAVKVSIGDVPCSLLPDRYTVS
LELVCITGWSADEKTDIVQVDVEQSGTGTSKESFSYLLPKLLYMEPNKGYHAGGTKVTIT
GEHLDIGSQVRVMVNSTHECVITEKTDNVIECTMPAVTQAHVSSVSVCVEFENLPCQRDD
LSTTYTYKKNPTIFFIEPTKSYLSGGRTITVTGQGFDLVQSAVMQVEGIGQTLHIKHTGN
PMSSCSGNTSYPRGCSLKRNTLKCPCPQMCSVISNSTIHCPSHSSSESQQTSVRFFLNGV
LYTDEAFVDRGPGGGILQQRQDRALRYNTNGVVQSWNHIPINKGNIEKRDCCLINAAETD
QIYGQGENIVNVKAISLSIYSEPRPSAMFTERGFICSGLFILVQVGNFRHIIAKVQLGGS
ELAIVVSIVVCCVLLLLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAE
LQTDMTDLTKELNRSQGIPFLEYKQFVTRTFFPKVRENFFSPCDTNLNGNATNTTKPNVE
EGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLL
VDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINK
GSIDAITGKARYTLNEEWLLRENVEARPQLLFRILQNINVSFQGCGMDSLSVRVMHTDTV
CQVKEKTIEAFYKNLPFSQWPRAEDVDLEWLDSGANSKLLQDLDNSSVMEDGRKKLNTVF
HYQIPEGASLAMSLKDKKENTLGRGTSPSDTPISSLFDTLTHRRWRKHTHPLHHIQTYTL
TSRRERDMHSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDF
LEEQADKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHMDACLSVIAQAFI
DACSISDLQLGKDSPTNKLLYAKEIPEYKKRVQLYYQQIQEMSPLSEQEMNAHLAEESRK
YRNEFNTNLALTEIYKYAKRYRNQVVSALESNPTARRTQLHHKFEQVIALVEDNIYECCS
EA
Download sequence
Identical sequences H2TQT3
ENSTRUP00000027040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]