SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027041 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027041
Domain Number 1 Region: 1-476
Classification Level Classification E-value
Superfamily Sema domain 6.67e-97
Family Sema domain 0.0008
Further Details:      
 
Domain Number 2 Region: 1316-1440,1632-1816
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-34
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 818-909
Classification Level Classification E-value
Superfamily E set domains 0.000000000000522
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 478-531
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000174
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 908-979
Classification Level Classification E-value
Superfamily E set domains 0.000000000635
Family Other IPT/TIG domains 0.087
Further Details:      
 
Domain Number 6 Region: 999-1064
Classification Level Classification E-value
Superfamily E set domains 0.00000000257
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000027041
Domain Number - Region: 782-814
Classification Level Classification E-value
Superfamily Plexin repeat 0.0288
Family Plexin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027041   Gene: ENSTRUG00000010718   Transcript: ENSTRUT00000027150
Sequence length 1856
Comment pep:known_by_projection scaffold:FUGU4:scaffold_180:453955:507239:-1 gene:ENSTRUG00000010718 transcript:ENSTRUT00000027150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNFAVDPNSRKVYLATVNTIYQLNGTLSAEVEMRTGPVEDNLLCHAPQLPQAPCEHPKSL
TDNYNKLLELDREQGVVVVCGSVYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIAA
NHPNASTVGLIFKSGGNTRLLVGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNVKD
LPRLFTYDINPSEDNVFKIKQEVKSKNKLNFVHAFTQKTYSYIAFNNDAKMGHKESQPNS
ILARICLDTENPRKPSGPESRKLTESYIQMPLQCGFNGNIYNRLLSVYPADIPTEDGREP
ESHLFGVFSKGDRKSALCAFKFSDIEEEIRQGREKCSNSPSSDVQVLDSVIQGSGAACVQ
KGKLTLQLEQLNCGAAHLQHPLALRRPLRALPLVEYPALTSVSVDCVHNHTVVFLGTSNG
RLRKTEAFHPPLSSSRHCLLCLIRPLFPIVPDLFISLNDSNYLYLMTSHHMLRVKVAQCD
QWRSCGDCLGARDAHCGWCTLENRCSIQKECALGLLARSWISMGEGPQQCPSMTLTPPEI
SVSADIKDVGILINGSVPDLLGSRVECEYGPGVSTSATVHLDSGPAQIQTCPLLSFWFPG
LSLAVPKQASSKKTDKWKRGCSTRPHFRNEPHNRCVSCLSARWKCYWDQENHLCVSNKDE
SNLHLIESATSCPSLLASEVPPAPSGTAQDFTLSLRNVQEPHSSQQGEELECDFGTEQRY
EATWVNSSVVKCSGITLFTYHRSQIYHLNLRRKRFYSGRGEDVFVDSPQPVKVEVYNCKV
GSSDCSQCWGREDQGHLCGWCENSCKPRDDCQPIVEQCASPEIHKIFPLRGPVEGGTLLT
VQGRNLGRRAEAVKVSIGDVPCSLLPDRYTVSLELVCITGWSADEKTDIVQVDVEQSGTG
TSKESFSYLLPKLLYMEPNKGYHAGGTKVTITGEHLDIGSQVRVMVNSTHEFHRKTDNVI
ECTMPAVTQAHVSSVSVCVEFENLPCQRDDLSTTYTYKKNPTIFFIEPTKSYLSGGRTIT
VTGQGFDLVQSAVMQVEGIGQTVSNQMCSVISNSTIHCPSHSSTECFPTAEPISRRKEGF
YFNRDKKDLMCLLNFCAFSYSFKPTAKFPTMQPDSPFHQILPACVSTHSPCDDITAAREQ
EYSVMIGSYPCNISFHNDQLFHCTINGLLGSSERELPVTVQVGNFRHIIAKVQLGGSELA
IVVSIVVCCVLLLLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQT
DMTDLTKELNRSQGIPFLEYKQFVTRTFFPKVKTHPLLQDWQATNTTKPNVEEGITLFST
LLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLVDLIDASA
SKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGSIDAITG
KARYTLNEEWLLRENVEARPQNINVSFQGCGMDSLSVRVMHTDTVCQVKEKTIEAFYKNL
PFSQWPRAEDVDLEWLDSGANSKLLQDLDNSSVMEDGRKKLNTVFHYQEWGTLMTSVIII
LPVKALNYGIIPEGASLAMSLKDKFTSAFRSIYKPEKLKNRQPLLPQVLPHDELMETRKS
HRHSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQAD
KRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHMDACLSVIAQAFIDACSIS
DLQLGKDSPTNKLLYAKEIPEYKKRVQLYYQQIQEMSPLSEQEMNAHLAEESRKYRNEFN
TNLALTEIYKYAKRYRNQVVSALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences H2TQT4
ENSTRUP00000027041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]