SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027042 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027042
Domain Number 1 Region: 2-449
Classification Level Classification E-value
Superfamily Sema domain 1.31e-91
Family Sema domain 0.00085
Further Details:      
 
Domain Number 2 Region: 1289-1413,1609-1793
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-33
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 792-883
Classification Level Classification E-value
Superfamily E set domains 0.000000000000509
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 889-963
Classification Level Classification E-value
Superfamily E set domains 0.00000000000514
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 5 Region: 451-504
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000174
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 975-1042
Classification Level Classification E-value
Superfamily E set domains 0.00000000152
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000027042
Domain Number - Region: 756-788
Classification Level Classification E-value
Superfamily Plexin repeat 0.0288
Family Plexin repeat 0.0046
Further Details:      
 
Domain Number - Region: 1110-1158
Classification Level Classification E-value
Superfamily E set domains 0.088
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027042   Gene: ENSTRUG00000010718   Transcript: ENSTRUT00000027151
Sequence length 1833
Comment pep:known_by_projection scaffold:FUGU4:scaffold_180:453955:507209:-1 gene:ENSTRUG00000010718 transcript:ENSTRUT00000027151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVYLATVNTIYQLNGTLSAEVEMRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLEL
DREQGVVVVCGSVYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIAANHPNASTVGL
IFKSGGNTRLLVGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNVKDLPRLFTYDIN
PSEDNVFKIKQEVKSKNKLNFVHAFTQKTYSYIAFNNDAKMGHKESQPNSILARICLDTE
NPRKPSGPESRKLTESYIQMPLQCGFNEDGREPESHLFGVFSKGDRKSALCAFKFSDIEE
EIRQGREKCSNFEGMLEQHWGVTGRLIFLSHPAASPLQLEQLNCGAAHLQHPLALRRPLR
ALPLVEYPALTSVSVDCVHNHTVVFLGTSNGRLRKVLLSFQQIEGQHSPCLSPDVGQPLF
PIVPDLFISLNDSNYLYLMTSHHMLRVKVAQCDQWRSCGDCLGARDAHCGWCTLENRCSI
QKECALGLLARSWISMGEGPQQCPSMTLTPPEISVSADIKDVGILINGSVPDLLGSRVEC
EYGPGVSTSATVHLDSGPAQIQTCPLLPRENYQSILPDTVAIKVNGTSVVSGSFIIYDCE
RTDRCVSCLSARWKCYWDQENHLCVSNKDESNLHLIESATSCPSLLASEVPPAPSGTAQD
FTLSLRNVQEKSFTIIFAQQGEELECDFGTEQRYEATWVNSSVVKCSGITLFTYHRSQIY
HLNLRRKRFYSGRGEDVFVDSPQPVKVEVYNCKVGSSDCSQCWGREDQGHLCGWCENSCK
PRDDCQPIVEQCASPEIHKIFPLRGPVEGGTLLTVQGRNLGRRAEAVKVSIGDVPCSLLP
DRYTVSLELVCITGWSADEKTDIVQVDVEQSGTGTSKESFSYLLPKLLYMEPNKGYHAGG
TKVTITGEHLDIGSQVRVMVNSTHECVITEKTDNVIECTMPAVTQAHVSSVSVCVEFENL
PCQRDDLSTTYTYKKNPTIFFIEPTKSYLSGGRTITVTGQGFDLVQSAVMQVEGIGQTVS
NQMCSVISNSTIHCPSHSSNESSSSSDSEEEEDEEGEDGDPNKDHFLLEYVEDPQFFTAN
KEKLIKHHPGEPLTLIINFLAQKGPSDLDLVPEEYSVMIGSYPCNISFHNDQLFHCTING
LLGSSERELPVTVQVGNFRHIIAKVQLGGSELAIVVSIVVCCVLLLLCTVALVVYCTKSR
RAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKQFVTRT
FFPKVKTHPLLQDWQATNTTKPNVEEGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRC
SLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICM
YSYLKETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENVEARPQNINVSF
QGCGMDSLSVRVMHTDTVCQVKEKTIEAFYKNLPFSQWPRAEDVDLEWLDSGANSKLLQD
LDNSSVMEDGRKKLNTVFHYQEVIEDTEAYWLSRCNTALNVSCSCTQYLLILEIYISRPS
SCEYLNSPPISVVKDLDTEKYVHLVLPHDELMETRKSHRHSHRKKVLPEIYLTRLLSTKG
TLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFW
VNILKNPQFVFDIEKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYK
KRVQLYYQQIQEMSPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRNQVVSAL
ESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences H2TQT5
ENSTRUP00000027042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]