SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027542 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027542
Domain Number 1 Region: 49-158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-31
Family Spermadhesin, CUB domain 0.0000394
Further Details:      
 
Domain Number 2 Region: 1-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000878
Family EGF-type module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027542   Gene: ENSTRUG00000010903   Transcript: ENSTRUT00000027651
Sequence length 177
Comment pep:novel scaffold:FUGU4:scaffold_9372:78:2021:1 gene:ENSTRUG00000010903 transcript:ENSTRUT00000027651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECRERTDEALTCDHLCHNYIGGYYCSCRHGYLLHSDNHTCRVECSDGVFTDPSGVLS
SVDFPSPYPKSSECVYRIEAEPGCRLRLQFDPHFDVEDHPEISCPYDHVLVKAGSAVFGP
FCGDRSPGEIQTDSNVVTVFFHSDNSGENLGWKITYTSTGTHRYTPVHNDTRRPPKG
Download sequence
Identical sequences H2TS84
ENSTRUP00000027542 ENSTRUP00000027542 31033.ENSTRUP00000027542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]