SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027552 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027552
Domain Number 1 Region: 38-515
Classification Level Classification E-value
Superfamily Sema domain 8.24e-165
Family Sema domain 0.000000000141
Further Details:      
 
Domain Number 2 Region: 574-663
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000769
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 3 Region: 511-551
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000209
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027552   Gene: ENSTRUG00000010906   Transcript: ENSTRUT00000027661
Sequence length 767
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:565501:585668:-1 gene:ENSTRUG00000010906 transcript:ENSTRUT00000027661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTFFAPLLTLLFMPLKARGKINQGGIQTFFWTELIQNGRLLMLPLAAGDLHSLLPDEDG
KHLYVAMKDNLLSTSLDDITQNPRKLYWPASPDRVQECLMAGKDPELECANFLRVLQHFN
QTHLYVCGTGAFNPRCAFVSTSVFLKSEHQLLSYSQTECGKGKCPYDPFQKTASTVVDGE
LYAGITSDFMSRDSSFFRSLGGRRVIRTEQYDSTWLLDAQFVRVAPLSETDNPEDDKVYV
FFTERAQEAEGAAGKVLYSRVARVCKNDIGGQRSLVNKWSTFQKARLECSVPGPDGLHTH
FDQLQDIFILHGKDKKNPLIYGLFTTSSDILNGSAVCVYRMEDVVRAFKGNFLHKEGPQY
KWAEFTGKVPYPRPGTCPSTTYGSYSSTREYPDDVIFFSRTHPLLQESVLPLGERPLLVR
VGVHYKFSKLVVDRVEAVDSTYDVLFIGTDSGLVLKAIHLPKDHGQSQEITLEQMQVFQH
KSPVTAMTLSKKKQWLFVGSREGVSQLSLYQCELYGQACAECCLARDPYCTWDGHACSPY
MPTVRRRNARHLGEDEDPLTQCVRQGAGLQVEAEQRVMMVAEGNSTYLECLPRSRHAAVT
WYKQAGENSPELNQVVTGDQLVVIERGILIRQAELSHGGVYHCQVEEHGYHWTAVTVRLT
VWSPMADRLLASWSGSLHQSTGTQRWYEDVMALIHPGNIGQHCQALGYRPPRNQRRHGAI
TMGFYKEKEKGGRHKHEGGRARGGGGGGRAAGRKSRSKPQQRAPRSA
Download sequence
Identical sequences H2TS94
ENSTRUP00000027552 ENSTRUP00000027552 31033.ENSTRUP00000027552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]