SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027768 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027768
Domain Number 1 Region: 29-516
Classification Level Classification E-value
Superfamily Sema domain 1.7e-179
Family Sema domain 0.000000000034
Further Details:      
 
Domain Number 2 Region: 580-663
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000382
Family V set domains (antibody variable domain-like) 0.074
Further Details:      
 
Domain Number 3 Region: 512-565
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000384
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027768   Gene: ENSTRUG00000011002   Transcript: ENSTRUT00000027878
Sequence length 753
Comment pep:known_by_projection scaffold:FUGU4:scaffold_56:562588:579500:1 gene:ENSTRUG00000011002 transcript:ENSTRUT00000027878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGYLCVCVCMCVCVCVCLSGLSTDVINFLSFFPELKSTGTAHHFSFLLNSTDYRILRMDE
DHDRMYVGSKDYILSLDLNDINKDPLIIHWPVASQRKTECVHSGKDTNGECGNFIRLIEP
WNRTHLYVCGTGAYNPICTYVDRGRRSQEYIFRLEPGKVDSGKGKCPFDPKLNSVSALIN
GELYAGVYIDFMGTDSAIFRTLGQKTAMRTDQYNSRWLNDPTFVHAHLIPDSAEKNDDKL
YFFFREKASEMGQSPMTQSRIGRICLNDDGGHCCLVNKWSTFLKARLICSVPGADGIETH
FDELRDVYIQPTQDTKNPVIYGVFSVSGAVFKGSAVCVYSMADIRMVFNGPFAHKEGPNY
QWVAYTGKIPYPRPGTCPGGTFTPNMKSTKDYPDEVINFMRNHPTMYNVVYPVHKRPLVV
RTNVDYEFTTIAVDQVTAADGSYEVLFLGTDRGTVQKVIVLPRDDLQTEELVLEEVEVFK
VPTPITTMKISSKRQQLYVGSVLGVTHLALHRCDVYGEACADCCLARDPYCAWDGKSCSR
YSNSQKRSRRSRRQDVKYGNPIRQCRGYNSNSNKNTLETVQYGVEGSTTFLECQARSPHM
SLKWHLQKENSDRRKEIRSEGRVLKTEHGLLIRSLQPSDGGIYQCTSTEKNFKHTLVKLQ
LVVLSSRTVNNVLVETGSPALPPLQSSPWTPNAGQYKDLLTILSQPEMGLINQYCQDYWQ
LGEGGLGDGKAKSLKELKEQKKPRNRRHHDEET
Download sequence
Identical sequences H2TSW0
ENSTRUP00000027768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]