SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000028035 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000028035
Domain Number 1 Region: 163-330
Classification Level Classification E-value
Superfamily C-type lectin-like 6.18e-25
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 2 Region: 15-64
Classification Level Classification E-value
Superfamily Kelch motif 0.000000392
Family Kelch motif 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000028035
Domain Number - Region: 397-423
Classification Level Classification E-value
Superfamily Plexin repeat 0.000916
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000028035   Gene: ENSTRUG00000011106   Transcript: ENSTRUT00000028146
Sequence length 798
Comment pep:known_by_projection scaffold:FUGU4:scaffold_81:712724:744869:-1 gene:ENSTRUG00000011106 transcript:ENSTRUT00000028146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQTIQMVSDCFSACDEWRLLPKPDLHRDVNRFGHSAVVSNGSMYVFGGFSGMLLNDVLVY
RPPSCQAFVAEESCVLAGPGVRCIWSRGRCLSWEPSMANGSLIPDSFCPTKPATVDERCY
RFSDCASCTANTNGCQWCDDKKCISASSNCSSSVKNFPECPVRNEQLCTKLANCKSCSLN
LNCQWDQNQSQCHALPAQQCSEGWSQVGEACLRINSSRESYDNAQHYCKNLNGNIASLTT
PKQVDFVLEELKKLQQQDKRLSPWVGLRKINVSYWGWEDMTPFTNSSLRWLPGEPSDSGF
CAYLEEPQVTGLRANPCTATAHGLICEKATGNPSQSSRPSCKKPCSLHSNCANCTSQGME
CMWCSSAQRCVDSTAYVISFPYGQCLEWQTGDCVAQNCSGLRTCSQCLEQPECGWCGDPS
STGKGLCMEGSYRGPMKRPAKQGQPVQAHHQPQDMSLELNSCPREKGFEWAFIQCPACKC
NGHANVCQVLTGKCFCTTKGIKGDQCQLCDSENRYLGNPLRGTCYYNLLIDYQFTFSLIQ
EDDNHYTAINFMASPEQANKNLDMSINASNNFNLNITWSVGSTAGTISGEEVPIVSKTNI
KEYKDSFSCEKFTFRSNPNITFYVYVSNFSWPIKIQIAFSQHNNIMDLVQFFVTFFSCFL
SLLLVAAVVWKIKQTCWASRRREQLMRERQQMASRPFASVAVALDATAERMDLMQPVVDG
APKPVAMEPCSGGKAAVLTVLLHLPSGPSGLPPPGQSGLIVASALVDVSQQKPSDFKDKT
QSLKNRKALPPALQGTCV
Download sequence
Identical sequences H2TTM7
ENSTRUP00000028035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]