SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000028198 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000028198
Domain Number 1 Region: 87-221
Classification Level Classification E-value
Superfamily BAG domain 5.1e-50
Family BAG domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 26-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000599
Family Ubiquitin-related 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000028198   Gene: ENSTRUG00000011171   Transcript: ENSTRUT00000028310
Sequence length 221
Comment pep:known_by_projection scaffold:FUGU4:scaffold_80:655193:656862:-1 gene:ENSTRUG00000011171 transcript:ENSTRUT00000028310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRTQKSTMSEQSITVTVAYAFIFLTSGSTKHNITLTTHDETGPFVKDLSDALTAATGVP
QTSQKIIFKGKSLKDMEERLTSYGVKEGCKLMMIGKRNSPEEEAELKKLKDIEKSVEQTA
KKLEKVGGELTGLKNGFLAKDLQVEALGKLDHRVKTAAEQLMKTLEQIDALSVPENFSDC
RLKKKGLVKTVQGFLAECDKIEACISDHLSKIQSKNLALAD
Download sequence
Identical sequences H2TU40
ENSTRUP00000028198 ENSTRUP00000028198 31033.ENSTRUP00000028198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]