SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000029535 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000029535
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-38
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 2 Region: 149-256
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 258-372
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-32
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000029535   Gene: ENSTRUG00000011688   Transcript: ENSTRUT00000029652
Sequence length 376
Comment pep:known_by_projection scaffold:FUGU4:scaffold_90:802709:805142:1 gene:ENSTRUG00000011688 transcript:ENSTRUT00000029652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMGLRAAALIYLLLLVDKADSEKGHKGFKCGGILSASSGNISSPNFPSRYPYNSDCSWLI
VVAEGSSVHLTFHHFELEHHASCSYDYIKIYNGVAEDEGNLLGAFCGDVSPPQFTSSWNV
MSIIFHSDRHVAYRGFSVGYRKDMCGGVLTGLSGEISSPGYPLEYNNNADCTWTIRVSNA
SLVTLVFLDFQLENNEGCNFDFVALFDGPTVTHRHLGNYCGADKPPRVVTTSNNLLVAFK
SDFNIGGRGFKAYYYSGECQQVLVAVSGTFSSPRFPNIYPNNINCHWGITQASGYRVKLF
FPFLDLEERNSLSGECDYDSVTVYDGDSQADPMLGRWCGGERPPSLVSRGNKLLVVLSTD
RNEAHRGFTAAYLGGK
Download sequence
Identical sequences H2TXX6
ENSTRUP00000029535 ENSTRUP00000029535 31033.ENSTRUP00000029535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]