SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030165 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030165
Domain Number 1 Region: 86-204
Classification Level Classification E-value
Superfamily Integrin domains 4.13e-17
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 2 Region: 370-450
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000000589
Family Integrin beta tail domain 0.003
Further Details:      
 
Domain Number 3 Region: 23-69
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000188
Family Plexin repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 329-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Integrin beta EGF-like domains 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000030165
Domain Number - Region: 299-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number - Region: 211-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Integrin beta EGF-like domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030165   Gene: ENSTRUG00000011922   Transcript: ENSTRUT00000030282
Sequence length 450
Comment pep:novel scaffold:FUGU4:scaffold_22:1228969:1230720:-1 gene:ENSTRUG00000011922 transcript:ENSTRUT00000030282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHCLSLLLLLACSSRAKRPHCPKSATDCNECIRSGPDCAWCTAPDSDIRCQTSKVLRRAG
CPKDHIYNPRGEVQVARNDSSVEPVNADSLFLQPQELSVQLRPGVRQSFFITITRPSNQH
IRDLTMDASPLPVGVNITFNNIANRSPTVVEVLVKATGCLREKDNSNQMHNRTGPWSVQL
TPRGYSLGVKLEISLECQCECTKTRQESSLDCSGHGALVCGRCECDEPYAGQRCHSNLDS
SSQNEDACRPGPNEPVCSNRGRCVEGFCECAQRENPDEKYSGRYCECANFDCPYWNGRRV
CGGRGQCMCGQCLCDDGWTDDDCACSMDTAACMTSNGMLCNGKGTCQCGICKCEPPYAGP
TCETCPFCQGPCLRYSACAECQAFGTGAAKDRCERECSSVTVTMVETRHDLAEQLCKMRS
RDDMCSFYFSYSRTASGPQLTVARAKDCPN
Download sequence
Identical sequences H2TZQ6
31033.ENSTRUP00000030165 ENSTRUP00000030165 ENSTRUP00000030165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]