SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030363 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030363
Domain Number 1 Region: 19-207,260-365,461-558
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.59e-65
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000030363
Domain Number - Region: 387-425
Classification Level Classification E-value
Superfamily Plexin repeat 0.0837
Family Plexin repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030363   Gene: ENSTRUG00000011997   Transcript: ENSTRUT00000030480
Sequence length 600
Comment pep:known_by_projection scaffold:FUGU4:scaffold_191:332226:335339:-1 gene:ENSTRUG00000011997 transcript:ENSTRUT00000030480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EESAGQAPVTPSFVYVLAFFSALGGFLFGYDTGVVSGAMLPLKKEMNLNKLWQELLVSST
VGAAAVSSLGGGFLNGWLGRRICILIASFIFSIGGVILGLAPNKEVLLVGRVTVGLGIGI
ASMTVPVYIAEVSPPHQRGQLVTINSLFITGGQFIASLIDGAFSYLAHDSWRYMLALSAV
PAVLQFIGFIFLPESPRWLLQSGRTHEAHDVLRRIRGGRSVDVEYESIKTSIEDEEREAG
GDQQNEMQMFQLSCPALCRPARVDAPVILRILRHGPTRRALIVGCGLQMFQQLSGINTVM
YYSATILQMAGIRDDKRAIWLTAATSGCNFVFTLLGVWLVDRLGRRKLTLGSLCGTGLGL
ALLALGFLLSAQNAPSISLHPLDPQNSTCSLYETCQPCMLDPLCGFCYRDNGTAVYDSSC
VPANQTYTSLASWGRCSNQSEAADGLFWAYNYCPTSYSWLVLLGLLLYLAFFAPGMGTMP
WTVNSEIYPLWARSTGNACSSGVNWIFNVLVSLTFLHVAEFLTYQGAFFMYAGLVVLGLF
FILGCLPETQGLQLEDIESLFSGPLCSCGASSRNDRRNVQYIRVKGSNYRLSESDASDVD
Download sequence
Identical sequences H2U0A4
31033.ENSTRUP00000030363 ENSTRUP00000030363 ENSTRUP00000030363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]