SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030364 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030364
Domain Number 1 Region: 256-372
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000000000275
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 
Domain Number 2 Region: 1-48,93-140
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000000288
Family Glycerol-3-phosphate transporter 0.041
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000030364
Domain Number - Region: 195-233
Classification Level Classification E-value
Superfamily Plexin repeat 0.0379
Family Plexin repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030364   Gene: ENSTRUG00000011997   Transcript: ENSTRUT00000030481
Sequence length 414
Comment pep:known_by_projection scaffold:FUGU4:scaffold_191:332226:334019:-1 gene:ENSTRUG00000011997 transcript:ENSTRUT00000030481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYMLALSAVPAVLQFIGFIFLPESPRWLLQSGRTHEAHDVLRRIRGGRSVDVEYESIKTS
IEDEEREAGGGERPHSHQQNEMQMFQLSCPALCRPARVDAPVILRILRHGPTRRALIVGC
GLQMFQQLSGINTVMYVTHMFTAPPLLPSQGPPLRADPFLSPGTGLGLALLALGFLLSAQ
NAPSISLHPLDPQNSTCSLYETCQPCMLDPLCGFCYRDNGTAVYDSSCVPANQTYTSLAS
WGRCSNQSEAADGLFWAYNYCPTSYSWLVLLGLLLYLAFFAPGMGTMPWTVNSEIYPLWA
RSTGNACSSGVNWIFNVLVSLTFLHVAEFLTYQGNGTPAWAFFMYAGLVVLGLFFILGCL
PETQGLQLEDIESLFSGPLCSCGASSRNDRRNVQYIRVKGSNYRLSESDASDVD
Download sequence
Identical sequences H2U0A5
ENSTRUP00000030364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]