SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000031278 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000031278
Domain Number 1 Region: 22-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-33
Family Spermadhesin, CUB domain 0.0000481
Further Details:      
 
Domain Number 2 Region: 185-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-29
Family Spermadhesin, CUB domain 0.0000141
Further Details:      
 
Domain Number 3 Region: 137-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000196
Family EGF-type module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000031278   Gene: ENSTRUG00000012352   Transcript: ENSTRUT00000031400
Sequence length 297
Comment pep:known_by_projection scaffold:FUGU4:scaffold_20:931680:935639:-1 gene:ENSTRUG00000012352 transcript:ENSTRUT00000031400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHFCPSGRCAFVLLLLLRVTHGVNVTGLYGSFTSPNFPLPYPDDQHVVWNISVPGGHRIR
LYFGHFSLEPSNRCEYDYVQVLAGGNETLRFCDEEEKDSESTPGNMVILTAGNLMSVVFR
SDYSNEGRFTGFQAFYSAEDINECVSGIDGERACDHLCHNYIGGYYCTCRRGYLLHHDRR
SCTVPCSGQLLTSPSGVLTSPDYPGSYPPMSQCDYSIRLPEGFRITLAFLEPFDVEGHPD
VPCPYDVLKVSAPGREYGPFCGSVPPARINTGSFQVHVLFTSDASGRNQGWKIQYNS
Download sequence
Identical sequences H2U2W7
ENSTRUP00000031278 31033.ENSTRUP00000031278 ENSTRUP00000031278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]