SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000031357 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000031357
Domain Number 1 Region: 251-352
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 4.36e-19
Family SWIB/MDM2 domain 0.013
Further Details:      
 
Domain Number 2 Region: 355-452
Classification Level Classification E-value
Superfamily eIF1-like 0.000000000000157
Family eIF1-like 0.011
Further Details:      
 
Domain Number 3 Region: 93-177
Classification Level Classification E-value
Superfamily PUA domain-like 0.000000000000541
Family PUA domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000031357   Gene: ENSTRUG00000012383   Transcript: ENSTRUT00000031479
Sequence length 461
Comment pep:known_by_projection scaffold:FUGU4:scaffold_75:1074904:1080481:-1 gene:ENSTRUG00000012383 transcript:ENSTRUT00000031479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVRPFRVKSNTAIKGSDRRKLRADIAAAFPSLDADDLSELVPNKEELNIVKIYAHKGDA
VTLYVLHKNPLFFELEKRLYPTVYALWRYPALLPIFRTWPPVIQKLLGGADLMLPGVVLP
SSGLPHVQQGDCCAVTVVSNRAPVAVGTAALSSAEMLSSGMRGRGVSVLHTYMDNLCPSG
KKLDMKKSSYKKLSKFLQAMQRHNLVRLKELTKGVESIVEVDWKNEELRSFRAPEEADLE
ACVMDAGEGQTPYCPPEIVILYSVSARTEPLFLDANKRKGTILQPSEVRNIITEYVKNNE
LVNENNKNYVSINPTLCDCLLEKSEFQEVDSLKWDDLFSRTLGRMQECYQLVFPGQAPVI
KKGHIEQIDISVASRGSNKKVTLIKNLEVYGLDPTMVSTTLQHRVQASTVLQPIPGSKDK
VLVQVQGNQIHQAGSLLLDYFKIPRKYIQGLEKAPKGGKKK
Download sequence
Identical sequences H2U346
ENSTRUP00000031357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]