SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000031358 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000031358
Domain Number 1 Region: 340-417
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 0.00000000000000807
Family SWIB/MDM2 domain 0.013
Further Details:      
 
Domain Number 2 Region: 93-181
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000000000000155
Family PUA domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000031358   Gene: ENSTRUG00000012383   Transcript: ENSTRUT00000031480
Sequence length 458
Comment pep:known_by_projection scaffold:FUGU4:scaffold_75:1075208:1080481:-1 gene:ENSTRUG00000012383 transcript:ENSTRUT00000031480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVRPFRVKSNTAIKGSDRRKLRADIAAAFPSLDADDLSELVPNKEELNIVKIYAHKGDA
VTLYVLHKNPLFFELEKRLYPTVYALWRYPALLPIFRTWPPVIQKLLGGADLMLPGVVLP
SSGLPHVQQGDCCAVTVVSNRAPVAVGTAALSSAEMLSSGMRGRGVSVLHTYMDNLWSFG
DKSGPPALPDLESEGGEANGEECDHAEEEQEEEESPCGEACCGIEELSLTVQAEQENERS
IEEDEQEDQKTTQEDMDALLLQCFLHALKQKVKKSELPLLTSTFLRNHMFSCCPSGKKLD
MKKSSYKKLSKFLQAMQRHNLVRLKELTKGVESIVEVDWKNEEKGTILQPSEVRNIITEY
VKNNELVNENNKNYVSINPTLCDCLLEKSEFQEVDSLKWDDLFSRTLGRMQECYQLVFPG
QAPVIKKGHIEQIDISVASRGSNKKPLCLILPVGHIDK
Download sequence
Identical sequences H2U347
ENSTRUP00000031358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]