SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032956 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032956
Domain Number 1 Region: 22-489
Classification Level Classification E-value
Superfamily Sema domain 3.92e-121
Family Sema domain 0.0000296
Further Details:      
 
Domain Number 2 Region: 1330-1459,1654-1843
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.06e-51
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 838-936
Classification Level Classification E-value
Superfamily E set domains 5.98e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 934-1023
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000382
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 1022-1126
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000812
Family E-set domains of sugar-utilizing enzymes 0.059
Further Details:      
 
Domain Number 6 Region: 492-541
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000876
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 790-825
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000667
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1137-1214
Classification Level Classification E-value
Superfamily E set domains 0.0000962
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032956   Gene: ENSTRUG00000012993   Transcript: ENSTRUT00000033081
Sequence length 1873
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:994853:1033769:-1 gene:ENSTRUG00000012993 transcript:ENSTRUT00000033081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPALCYMRQLFQSVGERPGRVVYKTFDTSLTHLTVHRKTGEVFVGAVNRVLKLSANLTEL
RSHMTGPVEDNAKCYPPPSVRACAHRLEWSDNVNKLLLVDYTGNRLVACGSIWQGVCQFL
RLEDLFKLGEPHHRKEHYLSGAREADGMAGKLHLMERSGSRLFIGAAIDGKSEYFPTLSS
RKLVADEESVNMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYVYGFSSRTYVYFLTLQL
DTQLTQMDAGGEKFFTSKIVRMCSNDTDFYSYVEFPLGCTKDGVEYRLVQAAYKQKPGRR
LAQALGLSEEDDVLFVIFSQGQKNRSNPPRETVLCLFTLHDINLAMRERIRSCYRGEGRL
SLPWLLNKELPCIHTPKKIGDDFCGLVLNQPLGGLRVIEGNPLYEDRTEGMGAVAAYTYG
EHTVVFVGTRSGQLKKIRVDGIPSPSQNALLYETVTVVDGKPILRDMVFSPDHQYIYLLS
DRQVSRLPVESCEQYTSCSDCLGSGDPHCGWCVLFNMCSRQEACEKWEEPQHFNNKLDQC
VDISVTPSNMSVTSPSTELTVRVQNVPALSGGVSCVFDDLSETPGEVLAKGQVVCMSPSL
RELPVHTQSYAEQRVVQLSLRSTETGHQFISTSFIYYNCSVLNSCTSCVSSVFPCHWCKY
RHICTNNLQDCSFQEGRVSNMEGCPQILPTSDILVPAGMVRPITLRARNLPQPQSGQKNY
ECVFNIQGKVQRIPAVRFNSSCIQCQNTSYWYEGDESGDLPVDFSIVWDGDFFIDKPMSM
KALLYKCEAQRSSCGQCLKAPPAFECGWCVETRKCLLRQHCPTPEQSWMHHGRHNLRCSH
PRITKISPLTGPREGGTRVTIEGENLGLQVKEITHVQVAGVRCSSVPSQYISAERIVCDM
AEALLPHSPGGPVELCIGVCSAEFRTLSSQTYSFVSPSFSRVHPEKGPVSGGTRLTITGR
HLDAGSTVSVYINKEECLFVKRTNREIICITPASSSGSGPASIRLMIDKAEVTSSETKYV
YTEDPTIISIEPNWTILNGSTMITVTGTNLLTIQEPKVRAKYGGVETNNFCTLVNDSTMT
CLAPGLVYNKSVPPEGALHPEEFGFIFDQVSSLLVLNSTPFTHYPNPIFDPLGNSGILEV
KPGSPIILKGKNLIPPAPGNNRLNYTVLIGESPCLLTVSESQLLCDSPDLTGEHRVLILV
GGLEYSPGMLHIYSDSALTLPAIIGIGAGGGVLFIAIIAVLIAYKRKTRDADRTLKRLQL
QMDNLESRVALECKEAFAELQTDIQELTNDMDGVKIPFLEYCTYTMRVMFPGIEEHPVLK
ELDSPANVEKALRLFSQLLNNKIFLLTFIHTLEAQRSFSMRDRGNVASLLMAALQGRMEY
ATVVLKQLLADLIEKNLENRNHPKLLLRRTESVAEKMLTNWFTFLLHRFLKECAGEPLFM
LYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKQLTLMCIPPEGEAGTEVPVKVL
NCDTVTQVKDKLLDAVYKGIPFSQRPQADDMDLEWRQGRLTRIILQDEDVTTKIESDWKR
LNTLAHYQVTDGSLVALVQKQVSAYNIANSFTFTRSLSKYESLLRTSSSPDSLRSRAPMI
TPDQETGTKLWHLVKNHEHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFS
TAHRGSALPLAIKYMFDFLDEQADKRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDI
HKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDIAKM
PSISDQDMDAYLVEQSRLHGNEFNTLSALSELYFYINKYKEEILTALDRDGYCRKHKLRH
KLEQAINLMSGSS
Download sequence
Identical sequences H2U7P0
ENSTRUP00000032956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]