SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032959 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032959
Domain Number 1 Region: 877-1006,1166-1355
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-52
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 372-470
Classification Level Classification E-value
Superfamily E set domains 4.11e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 3 Region: 468-557
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000215
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 4 Region: 556-660
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000574
Family E-set domains of sugar-utilizing enzymes 0.059
Further Details:      
 
Domain Number 5 Region: 32-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000615
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 324-359
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000471
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 2-35
Classification Level Classification E-value
Superfamily Sema domain 0.0000706
Family Sema domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000032959
Domain Number - Region: 696-747
Classification Level Classification E-value
Superfamily E set domains 0.0114
Family Other IPT/TIG domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032959   Gene: ENSTRUG00000012993   Transcript: ENSTRUT00000033084
Sequence length 1381
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:994868:1012677:-1 gene:ENSTRUG00000012993 transcript:ENSTRUT00000033084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPILRDMVFSPDHQYIYLLSDRQVSRLPVESCEQYTSCSDCLGSGDPHCGWCVLFNMCSR
QEACEKWEEPQHFNNKLDQCVDISVTPSNMSVTSPSTELTVRVQNVPALSGGVSCVFDDL
SETPGEVLAKGQVVCMSPSLRELPVHTQSYAEQRVVQLSLRSTETGHQFISTSFIYYNCS
VLNSCTSCVSSVFPCHWCKYRHICTNNLQDCSFQEGRGCPQILPTSDILVPAGMVRPITL
RARNLPQPQSGQKNYECVFNIQGKVQRIPAVRFNSSCIQCQNTSLSHTQWDMAAAKVSRT
FWDGDFFIDKPMSMKALLYKCEAQRSSCGQCLKAPPAFECGWCVETRKCLLRQHCPTPEQ
SWMHHGRHNLRCSHPRITKISPLTGPREGGTRVTIEGENLGLQVKEITHVQVAGVRCSSV
PSQYISAERIVCDMAEALLPHSPGGPVELCIGVCSAEFRTLSSQTYSFVSPSFSRVHPEK
GPVSGGTRLTITGRHLDAGSTVSVYINKEECLFVKRTNREIICITPASSSGSGPASIRLM
IDKAEVTSSETKYVYTEDPTIISIEPNWTILNGSTMITVTGTNLLTIQEPKVRAKYGGVE
TNNFCTLVNDSTMTCLAPGLVYNKSVPPEGALHPEEFGFIFDQVSSLLVLNSTPFTHYPN
PIFDPLGNSGILEVKPGSPIILKVRKHLLDVQQRRKNYTVLIGESPCLLTVSESQLLCDS
PDLTGEHRVLILVGGLEYSPGMLHIYSDSALTLPAIIGIGAGGGVLFIAIIAVLIAYKRK
TRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIQELTNDMDGVKIPFLEYCTYTMR
VMFPGIEEHPVLKELDVGASHRRHFIVQTQSPANVEKALRLFSQLLNNKIFLLTFIHTLE
AQRSFSMRDRGNVASLLMAALQGRMEYATVVLKQLLADLIEKNLENRNHPKLLLRRTESV
AEKMLTNWFTFLLHRFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQ
QIDYKQLTLMCIPPEGEAGTEVPVKVLNCDTVTQVKDKLLDAVYKGIPFSQRPQADDMDL
EWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSLVALVQKQSNTLNSISVLGT
KLWHLVKNHEHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTAHRGSAL
PLAIKYMFDFLDEQADKRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDA
CLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDIAKMPSISDQDM
DAYLVEQSRLHGNEFNTLSALSELYFYINKYKEEILTALDRDGYCRKHKLRHKLEQAINL
M
Download sequence
Identical sequences H2U7P3
ENSTRUP00000032959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]