SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032960 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032960
Domain Number 1 Region: 895-1024,1197-1386
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.65e-52
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 369-467
Classification Level Classification E-value
Superfamily E set domains 4.3e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 3 Region: 465-554
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000196
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 4 Region: 553-619
Classification Level Classification E-value
Superfamily E set domains 0.000000000000476
Family E-set domains of sugar-utilizing enzymes 0.059
Further Details:      
 
Domain Number 5 Region: 10-59
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000641
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 321-356
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000484
Family Plexin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000032960
Domain Number - Region: 707-779
Classification Level Classification E-value
Superfamily E set domains 0.00108
Family E-set domains of sugar-utilizing enzymes 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032960   Gene: ENSTRUG00000012993   Transcript: ENSTRUT00000033085
Sequence length 1412
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:994868:1011248:-1 gene:ENSTRUG00000012993 transcript:ENSTRUT00000033085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSRLPVESCEQYTSCSDCLGSGDPHCGWCVLFNMCSRQEACEKWEEPQHFNNKLDQCVD
ISVTPSNMSVTSPSTELTVRVQNVPALSGGVSCVFDDLSETPGEVLAKGQVVCMSPSLRE
LPVHTQSYAEQRVVQLSLRSTETGHQFISTSFIYYNCSVLNSLSLSLRCTSCVSSVFPCH
WCKYRHICTNNLQDCSFQEGRVSNMEGVNLKYRGCPQILPTSDILVPAGMVRPITLRARN
LPQPQSGQKNYECVFNIQGKVQRIPAVRFNSSCIQCQNTSYWYEGDESGDLPVDFSIVWD
GDFFIDKPMSMKALLYKCEAQRSSCGQCLKAPPAFECGWCVETRKCLLRQHCPTPEQSWM
HHGRHNLRCSHPRITKISPLTGPREGGTRVTIEGENLGLQVKEITHVQVAGVRCSSVPSQ
YISAERIVCDMAEALLPHSPGGPVELCIGVCSAEFRTLSSQTYSFVSPSFSRVHPEKGPV
SGGTRLTITGRHLDAGSTVSVYINKEECLFVKRTNREIICITPASSSGSGPASIRLMIDK
AEVTSSETKYVYTEDPTIISIEPNWTILNGSTMITVTGTNLLTIQEPKVRAKYGGVETNN
FCTLVNDSTMTCLAPGLVYSNTHGSASHTIFSLCSKSRILDLIWDPTHICIYPLVYGLVI
FVAPKVSSLLVLNSTPFTHYPNPIFDPLGNSGILEVKPGSPIILKVRKHLLDVQGKNLIP
PAPGNNRLNYTVLIGESPCLLTVSESQLLCDSPDLTGEHRVLILVGGLEYSPGMLHIYSD
SALTLPAIIGIGAGGGVLFIAIIAVLIAYKRKTRDADRTLKRLQLQMDNLESRVALECKE
AFAELQTDIQELTNDMDGVKIPFLEYCTYTMRVMFPGIEEHPVLKELDSPANVEKALRLF
SQLLNNKIFLLTFIHTLEAQRSFSMRDRGNVASLLMAALQGRMEYATVVLKQLLADLIEK
NLENRNHPKLLLRRTESVAEKMLTNWFTFLLHRFLKECAGEPLFMLYCAIKQQMEKGPID
AITGEARYSLSEDKLIRQQIDYKQLTLMCIPPEGEAGTEVPVKVLNCDTVTQVKDKLLDA
VYKGIPFSQRPQADDMDLEWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSLV
ALVQSLLRTSSSPDSLRSRAPMITPDQETGTKLWHLVKNHEHSDQREGDRGSKMVSEIYL
TRLLATKGTLQKFVDDLFETVFSTAHRGSALPLAIKYMFDFLDEQADKRQISDPDVRHTW
KSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKL
LYAKDIPNYKSWVERYYRDIAKMPSISDQDMDAYLVEQSRLHGNEFNTLSALSELYFYIN
KYKEEILTALDRDGYCRKHKLRHKLEQAINLM
Download sequence
Identical sequences H2U7P4
ENSTRUP00000032960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]