SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032961 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032961
Domain Number 1 Region: 25-470
Classification Level Classification E-value
Superfamily Sema domain 6.15e-112
Family Sema domain 0.0000699
Further Details:      
 
Domain Number 2 Region: 1309-1438,1607-1796
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-52
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 806-904
Classification Level Classification E-value
Superfamily E set domains 5.79e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 902-991
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000356
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 473-522
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000085
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 758-793
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000366
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 990-1091
Classification Level Classification E-value
Superfamily E set domains 0.0000644
Family Other IPT/TIG domains 0.069
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000032961
Domain Number - Region: 1103-1165
Classification Level Classification E-value
Superfamily E set domains 0.000945
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032961   Gene: ENSTRUG00000012993   Transcript: ENSTRUT00000033086
Sequence length 1817
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:994883:1033336:-1 gene:ENSTRUG00000012993 transcript:ENSTRUT00000033086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSLLLFLLSLSTMIPSASSLAPRRVVYKTFDTSLTHLTVHRKTGEVFVGAVNRVLKLSAN
LTELRSHMTGPVEDNAKCYPPPSVRACAHRLEWSDNVNKLLLVDYTGNRLVACGSIWQGV
CQFLRLEDLFKLGEPHHRKEHYLSGAREADGMAALVICLSAAASNFVFTSTFNAVHQQDE
FVSSQIKIPSDTLSLYPAFDIYYVYGFSSRTYVYFLTLQLDTQLTQMDAGGEKFFTSKIV
RMCSNDTDFYSYVEFPLGCTKDGVEYRLVQAAYKQKPGRRLAQALGLSEEDDVLFVIFSQ
GQKNRSNPPRETVLCLFTLHDINLAMRERIRSCYRGEVRQVRPIFFRPRVTSTKSGGQRK
PKKIGDDFCGLVLNQPLGGLRVIEGNPLYEDRTEGMGAVAAYTYGEHTVVFVGTRSGQLK
KVFKTKPLFKGKYETVTVVDGKPILRDMVFSPDHQYIYLLSDRQVSRLPVESCEQYTSCS
DCLGSGDPHCGWCVLFNMCSRQEACEKWEEPQHFNNKLDQCVDISVTPSNMSVTSPSTEL
TVRVQNVPALSGGVSCVFDDLSETPGEVLAKGQVVCMSPSSQHLSPSIQHVLCCLAWFLI
QKSSLPLSMSLSPSLSLSLSLSLRCTSCVSSVFPCHWCKYRHICTNNLQDCSFQEGRVSN
MEGCPQILPTSDILVPAGMVRPITLRARNLPQPQSGQKNYEERFSASLPSASTLHAFSAR
TPRLSYPFPEEIDHLVKKNNRQKPDSQIHVVLIQCEAQRSSCGQCLKAPPAFECGWCVET
RKCLLRQHCPTPEQSWMHHGRHNLRCSHPRITKISPLTGPREGGTRVTIEGENLGLQVKE
ITHVQVAGVRCSSVPSQYISAERIVCDMAEALLPHSPGGPVELCIGVCSAEFRTLSSQTY
SFVSPSFSRVHPEKGPVSGGTRLTITGRHLDAGSTVSVYINKEECLFVKRTNREIICITP
ASSSGSGPASIRLMIDKAEVTSSETKYVYTEDPTIISIEPNWTILNGSTMITVTGTNLLT
IQEPKNKSVPPEGALHPEEFGFIFDQSRILDLIWDPTHICIYPLVYGLVIFVAPKVSSLL
VLNSTPFTHYPNPIFDPLGNSGILEVKPGSPIILKGKNLIPPAPGNNRLNYTVLIGESPC
LLTVSESQLLCDSPDLTGEHRVLVSHAPVEQKILVGGLEYSPGMLHIYSDSALTLPAIIG
IGAGGGVLFIAIIAVLIAYKRKTRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIQ
ELTNDMDGVKIPFLEYCTYTMRVMFPGIEEHPVLKELDVGASHRPNVEKALRLFSQLLNN
KIFLLTFIHTLEAQRSFSMRDRGNVASLLMAALQGRMEYATVVLKQLLADLIEKNLENRN
HPKLLLRRTESVAEKMLTNWFTFLLHRFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEA
RYSLSEDKLIRQQIDYKQLTLMCIPPEGEAGTEVPVKVLNCDTVTQVKDKLLDAVYKGIP
FSQRPQADDMDLEWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSLVALVQKQ
SEVQSTNDYPRPRDRYCNNGTKLWHLVKNHEHSDQREGDRGSKMVSEIYLTRLLATKGTL
QKFVDDLFETVFSTAHRGSALPLAIKYMFDFLDEQADKRQISDPDVRHTWKSNCLPLRFW
VNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYK
SWVERYYRDIAKMPSISDQDMDAYLVEQSRLHGNEFNTLSALSELYFYINKYKEEILTAL
DRDGYCRKHKLRHKLEQ
Download sequence
Identical sequences H2U7P5
ENSTRUP00000032961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]