SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032962 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032962
Domain Number 1 Region: 835-964,1133-1322
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.22e-52
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 351-449
Classification Level Classification E-value
Superfamily E set domains 4.02e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 3 Region: 447-536
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000187
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 4 Region: 10-59
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000602
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 535-628
Classification Level Classification E-value
Superfamily E set domains 0.00000000182
Family E-set domains of sugar-utilizing enzymes 0.059
Further Details:      
 
Domain Number 6 Region: 303-338
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000458
Family Plexin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000032962
Domain Number - Region: 621-694
Classification Level Classification E-value
Superfamily E set domains 0.04
Family E-set domains of sugar-utilizing enzymes 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032962   Gene: ENSTRUG00000012993   Transcript: ENSTRUT00000033087
Sequence length 1343
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:994883:1011248:-1 gene:ENSTRUG00000012993 transcript:ENSTRUT00000033087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSRLPVESCEQYTSCSDCLGSGDPHCGWCVLFNMCSRQEACEKWEEPQHFNNKLDQCVD
ISVTPSNMSVTSPSTELTVRVQNVPALSGGVSCVFDDLSETPGEVLAKGQVVCMSPSLRE
LPHLSPSIQHVLCCLAWFLIQKSSLPLSMSLSPSLSLSLSLSLRCTSCVSSVFPCHWCKY
RHICTNNLQDCSFQEGRVSNMEQGCPQILPTSDILVPAGMVRPITLRARNLPQPQSGQKN
YEERFSASLPSASTLHAFSARTPRLSYPFPEEIDHLLISAFHACVRLKHIFPVTALLYKC
EAQRSSCGQCLKAPPAFECGWCVETRKCLLRQHCPTPEQSWMHHGRHNLRCSHPRITKIS
PLTGPREGGTRVTIEGENLGLQVKEITHVQVAGVRCSSVPSQYISAERIVCDMAEALLPH
SPGGPVELCIGVCSAEFRTLSSQTYSFVSPSFSRVHPEKGPVSGGTRLTITGRHLDAGST
VSVYINKEECLFVKRTNREIICITPASSSGSGPASIRLMIDKAEVTSSETKYVYTEDPTI
ISIEPNWTILNGSTMITVTGTNLLTIQEPKVRAKYGGVETNNSRILDLIWDPTHICIYPL
VYGLVIFVAPKVSSLLVLNSTPFTHYPNPIFDPLGNSGILEGKNLIPPAPGNNRLNYTVL
IGESPCLLTVSESQLLCDSPDLTGEHRVLVSHAPVEQKILVGGLEYSPGMLHIYSDSALT
LPAIIGIGAGGGVLFIAIIAVLIAYKRKTRDADRTLKRLQLQMDNLESRVALECKEAFAE
LQTDIQELTNDMDGVKIPFLEYCTYTMRVMFPGIEEHPVLKELDVGASHRPNVEKALRLF
SQLLNNKIFLLTFIHTLEAQRSFSMRDRGNVASLLMAALQGRMEYATVVLKQLLADLIEK
NLENRNHPKLLLRRTESVAEKMLTNWFTFLLHRFLKECAGEPLFMLYCAIKQQMEKGPID
AITGEARYSLSEDKLIRQQIDYKQLTLMCIPPEGEAGTEVPVKVLNCDTVTQVKDKLLDA
VYKGIPFSQRPQADDMDLEWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSLV
ALVQKQSEVQSTNDYPRPRDRYCNNGTKLWHLVKNHEHSDQREGDRGSKMVSEIYLTRLL
ATKGTLQKFVDDLFETVFSTAHRGSALPLAIKYMFDFLDEQADKRQISDPDVRHTWKSNC
LPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAK
DIPNYKSWVERYYRDIAKMPSISDQDMDAYLVEQSRLHGNEFNTLSALSELYFYINKYKE
EILTALDRDGYCRKHKLRHKLEQ
Download sequence
Identical sequences H2U7P6
ENSTRUP00000032962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]